StarFunc result for job id Q8TBC4

User Input

>input (463 residues)
MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPST
ESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDI
GRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLI
SLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIA
SMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYR
LTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAER
KENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTS
IEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TBC4	1.000	1.000	3.365E-97	463	1.000	1.000	Q8TBC4.pdb.gz	UBA3_HUMAN NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens OX=9606 GN=UBA3 PE=1 SV=2
2	PDB:2nvuB	0.740	0.440	1.497E-81	789	0.931	0.546	2nvuB.pdb.gz	Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.
3	AFDB:Q9V6U8	0.917	0.944	2.149E-72	450	0.598	0.616	Q9V6U8.pdb.gz	UBA3_DROME Nedd8-activating enzyme E1 catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Uba3 PE=1 SV=1
4	AFDB:Q19360	0.870	0.934	1.679E-58	430	0.486	0.523	Q19360.pdb.gz	UBA3_CAEEL NEDD8-activating enzyme E1 catalytic subunit OS=Caenorhabditis elegans OX=6239 GN=rfl-1 PE=1 SV=2
5	AFDB:O65041	0.733	0.747	1.643E-54	454	0.425	0.434	O65041.pdb.gz	UBA3_ARATH NEDD8-activating enzyme E1 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=ECR1 PE=1 SV=2
6	AFDB:Q09765	0.687	0.715	1.554E-49	444	0.380	0.396	Q09765.pdb.gz	UBA3_SCHPO NEDD8-activating enzyme E1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uba3 PE=1 SV=1
7	AFDB:Q38F81	0.645	0.640	1.456E-37	467	0.320	0.317	Q38F81.pdb.gz	Q38F81_TRYB2 NEDD8-activating enzyme E1 catalytic subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3210 PE=3 SV=1
8	AFDB:Q99344	0.588	0.898	1.097E-32	299	0.285	0.441	Q99344.pdb.gz	UBA3_YEAST NEDD8-activating enzyme E1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA3 PE=1 SV=1
9	AFDB:Q9SJT1	0.695	0.474	5.495E-31	700	0.276	0.183	Q9SJT1.pdb.gz	SAE2_ARATH SUMO-activating enzyme subunit 2 OS=Arabidopsis thaliana OX=3702 GN=SAE2 PE=1 SV=1
10	AFDB:Q5BAI0	0.610	0.470	3.375E-30	610	0.272	0.207	Q5BAI0.pdb.gz	Q5BAI0_EMENI Ubiquitin-like activating enzyme (UbaB), putative (AFU_orthologue AFUA_6G10510) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02450 PE=3 SV=1
11	AFDB:Q9UBT2	0.689	0.514	6.665E-30	640	0.298	0.216	Q9UBT2.pdb.gz	SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2
12	PDB:3kycB	0.673	0.577	1.987E-29	548	0.287	0.243	3kycB.pdb.gz	Active site remodelling accompanies thioester bond formation in the SUMO E1.
13	PDB:6xoiB	0.563	0.643	5.581E-26	403	0.242	0.278	6xoiB.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
14	PDB:6cwyD	0.507	0.486	5.395E-25	487	0.259	0.246	6cwyD.pdb.gz	Molecular mechanism of a covalent allosteric inhibitor of SUMO E1 activating enzyme.
15	PDB:7pvnB	0.532	0.263	6.623E-21	990	0.225	0.105	7pvnB.pdb.gz	Structures of UBA6 explain its dual specificity for ubiquitin and FAT10.
16	PDB:7solA	0.554	0.264	9.308E-21	1011	0.238	0.109	7solA.pdb.gz	Crystal structures reveal catalytic and regulatory mechanisms of the dual-specificity ubiquitin/FAT10 E1 enzyme Uba6.
17	PDB:7k5jI	0.500	0.255	2.894E-20	979	0.259	0.123	7k5jI.pdb.gz	Crystal structures of an E1-E2-ubiquitin thioester mimetic reveal molecular mechanisms of transthioesterification.
18	PDB:5l6iA	0.542	0.258	5.103E-20	1007	0.238	0.109	5l6iA.pdb.gz	Dissecting the Specificity of Adenosyl Sulfamate Inhibitors Targeting the Ubiquitin-Activating Enzyme.
19	PDB:6dc6C	0.548	0.267	5.401E-20	996	0.225	0.104	6dc6C.pdb.gz	Crystal structure of a human ubiquitin E1-ubiquitin complex reveals conserved functional elements essential for activity.
20	PDB:4ii3A	0.572	0.280	1.129E-19	986	0.235	0.111	4ii3A.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C878	0.0	959	462	0.991	0.994	UBA3_MOUSE NEDD8-activating enzyme E1 catalytic subunit OS=Mus musculus OX=10090 GN=Uba3 PE=1 SV=2
2	Q8TBC4	0.0	964	463	1.000	1.000	UBA3_HUMAN NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens OX=9606 GN=UBA3 PE=1 SV=2
3	Q99MI7	0.0	959	462	0.991	0.994	UBA3_RAT NEDD8-activating enzyme E1 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Uba3 PE=1 SV=1
4	Q9V6U8	0.0	573	450	0.598	0.616	UBA3_DROME Nedd8-activating enzyme E1 catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Uba3 PE=1 SV=1
5	Q19360	2.30e-156	452	430	0.492	0.530	UBA3_CAEEL NEDD8-activating enzyme E1 catalytic subunit OS=Caenorhabditis elegans OX=6239 GN=rfl-1 PE=1 SV=2
6	O65041	2.87e-126	376	454	0.417	0.425	UBA3_ARATH NEDD8-activating enzyme E1 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=ECR1 PE=1 SV=2
7	Q09765	4.10e-117	352	444	0.393	0.410	UBA3_SCHPO NEDD8-activating enzyme E1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uba3 PE=1 SV=1
8	Q99344	5.66e-84	262	299	0.292	0.452	UBA3_YEAST NEDD8-activating enzyme E1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA3 PE=1 SV=1
9	Q38F81	5.46e-73	239	467	0.307	0.304	Q38F81_TRYB2 NEDD8-activating enzyme E1 catalytic subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3210 PE=3 SV=1
10	F1SFQ0	1.58e-63	203	122	0.203	0.770	F1SFQ0_PIG NEDD8-activating enzyme E1 catalytic subunit OS=Sus scrofa OX=9823 GN=UBA3 PE=1 SV=5
11	Q9UBT2	2.68e-45	169	640	0.214	0.155	SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2
12	Q9Z1F9	6.41e-45	168	638	0.214	0.155	SAE2_MOUSE SUMO-activating enzyme subunit 2 OS=Mus musculus OX=10090 GN=Uba2 PE=1 SV=1
13	O42939	8.98e-43	162	628	0.186	0.137	UBA2_SCHPO Ubiquitin-activating enzyme E1-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uba2 PE=1 SV=1
14	Q9SJT1	1.38e-42	162	700	0.184	0.121	SAE2_ARATH SUMO-activating enzyme subunit 2 OS=Arabidopsis thaliana OX=3702 GN=SAE2 PE=1 SV=1
15	Q5BAI0	3.38e-41	157	610	0.177	0.134	Q5BAI0_EMENI Ubiquitin-like activating enzyme (UbaB), putative (AFU_orthologue AFUA_6G10510) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02450 PE=3 SV=1
16	Q7KJV6	1.28e-40	156	700	0.188	0.124	Q7KJV6_DROME SUMO-activating enzyme subunit OS=Drosophila melanogaster OX=7227 GN=Uba2 PE=2 SV=1
17	Q7KUA4	1.42e-40	156	700	0.188	0.124	Q7KUA4_DROME SUMO-activating enzyme subunit OS=Drosophila melanogaster OX=7227 GN=Uba2 PE=1 SV=1
18	Q9VSD9	8.03e-39	151	700	0.184	0.121	Q9VSD9_DROME SUMO-activating enzyme subunit OS=Drosophila melanogaster OX=7227 GN=Uba2 PE=2 SV=3
19	P52488	7.44e-38	148	636	0.177	0.129	UBA2_YEAST Ubiquitin-activating enzyme E1-like OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA2 PE=1 SV=1
20	Q9NAN1	1.08e-36	144	582	0.175	0.139	SAE2_CAEEL SUMO-activating enzyme subunit uba-2 OS=Caenorhabditis elegans OX=6239 GN=uba-2 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08825 E2_bind	8e-21	85.3	E2 binding domain
2	PF00070 Pyr_redox	3.4e+02	13.2	Pyridine nucleotide-disulphide oxidoreductase
3	PF01488 Shikimate_DH	4.3	18.8	Shikimate / quinate 5-dehydrogenase
4	PF00899 ThiF	6.6e-56	200.5	ThiF family
5	PF14732 UAE_UbL	1.1	21.3	Ubiquitin/SUMO-activating enzyme ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010381347.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010353464.1	0.997	NEDD8-activating enzyme E1 regulatory subunit isoform X1
2	61622.XP_010359483.1	0.997	Belongs to the ubiquitin-conjugating enzyme family.
3	61622.XP_010356266.1	0.982	Belongs to the ubiquitin-conjugating enzyme family.
4	61622.XP_010362038.1	0.944	Neural precursor cell expressed, developmentally down-regulated 8
5	61622.XP_010374460.1	0.944	NEDD8
6	61622.XP_010375582.1	0.912	E1-like activating enzyme involved in the 2 ubiquitin-like systems required for cytoplasm to vacuole transport (Cvt) and autophagy. Activates ATG12 for its conjugation with ATG5 as well as the ATG8 family proteins for their conjugation with phosphatidylethanolamine. Both systems are needed for the ATG8 association to Cvt vesicles and autophagosomes membranes. Required for autophagic death induced by caspase-8 inhibition. Required for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy req [...]
7	61622.XP_010367482.1	0.908	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
8	61622.XP_010377075.1	0.871	Belongs to the ubiquitin-conjugating enzyme family.
9	61622.XP_010354336.1	0.855	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
10	61622.XP_010380488.1	0.845	Belongs to the ubiquitin-conjugating enzyme family.
11	61622.XP_010378494.1	0.837	Ubiquitin-like modifier-activating enzyme 5 isoform X1
12	61622.XP_010375713.1	0.836	SUMO-activating enzyme subunit 1 isoform X1
13	61622.XP_010369895.1	0.834	COP9 signalosome complex subunit 5
14	61622.XP_010357930.1	0.819	The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.
15	61622.XP_010384059.1	0.808	Belongs to the ubiquitin-conjugating enzyme family.
16	61622.XP_010386064.1	0.808	Cell division cycle 34
17	61622.XP_010356592.1	0.802	Ubiquitin C-terminal hydrolase L3
18	61622.XP_010386087.1	0.800	Chromosome transmission fidelity protein 18 homolog isoform X1
19	61622.XP_010351698.1	0.795	Belongs to the ubiquitin-conjugating enzyme family.
20	61622.XP_010386100.1	0.795	Belongs to the ubiquitin-conjugating enzyme family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008641	1.000	ubiquitin-like modifier activating enzyme activity
GO:0019781	0.888	NEDD8 activating enzyme activity
GO:0046983	0.810	protein dimerization activity
GO:0016740	0.801	transferase activity
GO:0019787	0.683	ubiquitin-like protein transferase activity
GO:0046982	0.317	protein heterodimerization activity
GO:0042802	0.312	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070647	0.996	protein modification by small protein conjugation or removal
GO:0065007	0.976	biological regulation
GO:0050789	0.967	regulation of biological process
GO:0050794	0.961	regulation of cellular process
GO:0032446	0.961	protein modification by small protein conjugation
GO:0009987	0.911	cellular process
GO:0019222	0.521	regulation of metabolic process
GO:0006508	0.486	proteolysis
GO:0080090	0.480	regulation of primary metabolic process
GO:0051171	0.479	regulation of nitrogen compound metabolic process
GO:0060255	0.471	regulation of macromolecule metabolic process
GO:0048519	0.395	negative regulation of biological process
GO:0031323	0.392	regulation of cellular metabolic process
GO:0048523	0.320	negative regulation of cellular process
GO:0045116	0.315	protein neddylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.999	protein-containing complex
GO:0005829	0.999	cytosol
GO:0070013	0.974	intracellular organelle lumen
GO:0005654	0.947	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.-.-	1.000	Forming carbon-sulfur bonds.
EC:6.2.1.64	0.888	E1 NEDD8-activating enzyme.
EC:2.-.-.-	0.801	Transferases.

[back to server]