StarFunc result for job id Q8TBE9

User Input

>input (248 residues)
MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKEC
FHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTE
LRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQ
PGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSI
DCKVSMST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5M969	0.999	0.999	1.329E-47	248	0.944	0.944	Q5M969.pdb.gz	NANP_RAT N-acylneuraminate-9-phosphatase OS=Rattus norvegicus OX=10116 GN=Nanp PE=1 SV=1
2	PDB:2w4mA	0.961	0.954	5.677E-45	250	0.968	0.960	2w4mA.pdb.gz
3	AFDB:P94512	0.795	0.761	3.996E-17	260	0.278	0.265	P94512.pdb.gz	PSP_BACSU Phosphoserine phosphatase OS=Bacillus subtilis (strain 168) OX=224308 GN=serB PE=1 SV=2
4	AFDB:Q72H00	0.707	0.705	2.145E-16	249	0.254	0.253	Q72H00.pdb.gz	PSP_THET2 Phosphoserine phosphatase OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=TT_C1695 PE=1 SV=1
5	AFDB:P0A8Y1	0.670	0.727	2.179E-15	225	0.238	0.262	P0A8Y1.pdb.gz	YJJG_ECOLI Pyrimidine 5'-nucleotidase YjjG OS=Escherichia coli (strain K12) OX=83333 GN=yjjG PE=1 SV=1
6	AFDB:Q8DPQ3	0.698	0.726	2.485E-14	237	0.206	0.215	Q8DPQ3.pdb.gz	PYNA_STRR6 Pyrimidine 5'-nucleotidase PynA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pynA PE=1 SV=1
7	AFDB:P0ADP0	0.655	0.678	4.436E-14	238	0.242	0.252	P0ADP0.pdb.gz	YIGB_ECOLI 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB OS=Escherichia coli (strain K12) OX=83333 GN=yigB PE=1 SV=1
8	AFDB:P32662	0.580	0.572	6.477E-12	252	0.206	0.202	P32662.pdb.gz	GPH_ECOLI Phosphoglycolate phosphatase OS=Escherichia coli (strain K12) OX=83333 GN=gph PE=1 SV=1
9	AFDB:Q8RYE9	0.591	0.597	1.225E-11	245	0.198	0.200	Q8RYE9.pdb.gz	GPPL3_ARATH Haloacid dehalogenase-like hydrolase domain-containing protein At2g33255 OS=Arabidopsis thaliana OX=3702 GN=At2g33255 PE=1 SV=1
10	AFDB:P95649	0.581	0.619	3.685E-11	230	0.173	0.187	P95649.pdb.gz	CBBY_CERSP Protein CbbY OS=Cereibacter sphaeroides OX=1063 GN=cbbY PE=1 SV=1
11	AFDB:Q9CYW4	0.681	0.673	4.138E-11	251	0.210	0.207	Q9CYW4.pdb.gz	HDHD3_MOUSE Haloacid dehalogenase-like hydrolase domain-containing protein 3 OS=Mus musculus OX=10090 GN=Hdhd3 PE=1 SV=1
12	PDB:4g9bA	0.631	0.680	5.378E-11	227	0.177	0.194	4g9bA.pdb.gz	Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
13	PDB:1te2A	0.543	0.603	1.526E-10	218	0.165	0.188	1te2A.pdb.gz	Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
14	PDB:4uauA	0.567	0.612	1.526E-10	226	0.173	0.190	4uauA.pdb.gz	Degradation of potent Rubisco inhibitor by selective sugar phosphatase.
15	PDB:3l5kA	0.581	0.612	6.133E-10	233	0.181	0.193	3l5kA.pdb.gz
16	PDB:7ef7A	0.534	0.557	6.133E-10	236	0.173	0.182	7ef7A.pdb.gz	Initiation of cytosolic plant purine nucleotide catabolism involves a monospecific xanthosine monophosphate phosphatase.
17	PDB:5olwA	0.572	0.624	4.400E-9	224	0.173	0.192	5olwA.pdb.gz	Observing enzyme ternary transition state analogue complexes by19F NMR spectroscopy.
18	PDB:3k1zA	0.696	0.714	1.768E-8	241	0.173	0.178	3k1zA.pdb.gz
19	PDB:3nuqA	0.555	0.517	1.768E-8	268	0.177	0.164	3nuqA.pdb.gz
20	PDB:4haiA	0.509	0.254	5.017E-8	548	0.165	0.075	4haiA.pdb.gz	Synthesis and structure-activity relationship of piperidine-derived non-urea soluble epoxide hydrolase inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TBE9	0.0	518	248	1.000	1.000	NANP_HUMAN N-acylneuraminate-9-phosphatase OS=Homo sapiens OX=9606 GN=NANP PE=1 SV=1
2	Q5M969	4.32e-179	493	248	0.944	0.944	NANP_RAT N-acylneuraminate-9-phosphatase OS=Rattus norvegicus OX=10116 GN=Nanp PE=1 SV=1
3	P94512	4.51e-23	96.3	260	0.298	0.285	PSP_BACSU Phosphoserine phosphatase OS=Bacillus subtilis (strain 168) OX=224308 GN=serB PE=1 SV=2
4	Q72H00	1.01e-14	73.6	249	0.198	0.197	PSP_THET2 Phosphoserine phosphatase OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=TT_C1695 PE=1 SV=1
5	P0A8Y1	6.26e-14	70.9	225	0.302	0.333	YJJG_ECOLI Pyrimidine 5'-nucleotidase YjjG OS=Escherichia coli (strain K12) OX=83333 GN=yjjG PE=1 SV=1
6	P0ADP0	3.89e-12	66.2	238	0.250	0.261	YIGB_ECOLI 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB OS=Escherichia coli (strain K12) OX=83333 GN=yigB PE=1 SV=1
7	Q8DPQ3	1.66e-08	55.8	237	0.230	0.241	PYNA_STRR6 Pyrimidine 5'-nucleotidase PynA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pynA PE=1 SV=1
8	P77475	1.40e-07	52.4	188	0.206	0.271	YQAB_ECOLI Fructose-1-phosphate phosphatase YqaB OS=Escherichia coli (strain K12) OX=83333 GN=yqaB PE=1 SV=1
9	P71447	3.56e-05	45.8	221	0.198	0.222	PGMB_LACLA Beta-phosphoglucomutase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=pgmB PE=1 SV=2
10	Q8VZ10	5.61e-05	46.2	1055	0.181	0.043	SOQ1_ARATH Protein SUPPRESSOR OF QUENCHING 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SOQ1 PE=1 SV=1
11	Q3ZBF9	8.39e-05	45.1	296	0.149	0.125	PLPP_BOVIN Chronophin OS=Bos taurus OX=9913 GN=PDXP PE=1 SV=1
12	P60487	4.60e-04	43.1	292	0.145	0.123	PLPP_MOUSE Chronophin OS=Mus musculus OX=10090 GN=Pdxp PE=1 SV=1
13	P31467	5.38e-04	42.4	221	0.181	0.204	YIEH_ECOLI 6-phosphogluconate phosphatase OS=Escherichia coli (strain K12) OX=83333 GN=yieH PE=1 SV=1
14	Q8VD52	7.43e-04	42.4	309	0.149	0.120	PLPP_RAT Chronophin OS=Rattus norvegicus OX=10116 GN=Pdxp PE=1 SV=2
15	Q6ZT62	8.80e-04	42.7	677	0.121	0.044	BGIN_HUMAN Bargin OS=Homo sapiens OX=9606 GN=BARGIN PE=1 SV=2
16	Q8RYE9	0.001	41.6	245	0.077	0.078	GPPL3_ARATH Haloacid dehalogenase-like hydrolase domain-containing protein At2g33255 OS=Arabidopsis thaliana OX=3702 GN=At2g33255 PE=1 SV=1
17	Q96GD0	0.001	41.6	296	0.141	0.118	PLPP_HUMAN Chronophin OS=Homo sapiens OX=9606 GN=PDXP PE=1 SV=2
18	Q9BSH5	0.002	41.2	251	0.125	0.124	HDHD3_HUMAN Haloacid dehalogenase-like hydrolase domain-containing protein 3 OS=Homo sapiens OX=9606 GN=HDHD3 PE=1 SV=1
19	Q9LDD5	0.004	40.4	373	0.085	0.056	PYRP2_ARATH 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PYRP2 PE=1 SV=1
20	A4QFW4	0.006	39.7	275	0.097	0.087	HDPA_CORGB Dihydroxyacetone phosphatase OS=Corynebacterium glutamicum (strain R) OX=340322 GN=hdpA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10079 BshC	5.1e+02	10.8	Bacillithiol biosynthesis BshC
2	PF05152 DUF705	37	15.3	Protein of unknown function (DUF705)
3	PF12710 HAD	86	15.1	haloacid dehalogenase-like hydrolase
4	PF13419 HAD_2	7.5e-24	96.3	Haloacid dehalogenase-like hydrolase
5	PF00702 Hydrolase	1.5e-11	56.6	haloacid dehalogenase-like hydrolase
6	PF13242 Hydrolase_like	9.1e-07	40.2	HAD-hyrolase-like
7	PF01884 PcrB	1.3e+02	13.5	PcrB family
8	PF09419 PGP_phosphatase	1.8e+02	13.1	Mitochondrial PGP phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302441

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229329	0.977	N-acylneuraminate cytidylyltransferase
2	9606.ENSP00000210444	0.971	Sialic acid synthase
3	9606.ENSP00000364782	0.802	Sialidase-1
4	9606.ENSP00000258317	0.726	N-acetylneuraminate lyase
5	9606.ENSP00000321343	0.722	Alpha-2,8-sialyltransferase 8E
6	9606.ENSP00000293970	0.710	TBC1 domain family member 24
7	9606.ENSP00000304364	0.705	C1GALT1-specific chaperone 1
8	9606.ENSP00000358840	0.698	Up-regulated during skeletal muscle growth protein 5
9	9606.ENSP00000379839	0.664	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
10	9606.ENSP00000342609	0.626	Alkaline ceramidase 2
11	9606.ENSP00000312709	0.611	Transcription initiation factor TFIID subunit 7
12	9606.ENSP00000394863	0.607	Palmitoyl-protein thioesterase 1
13	9606.ENSP00000365651	0.604	Natriuretic peptides B
14	9606.ENSP00000425759	0.601	Cytochrome c oxidase subunit 7C, mitochondrial
15	9606.ENSP00000363852	0.570	Choline transporter-like protein 1
16	9606.ENSP00000385215	0.549	Centrosomal protein of 162 kDa
17	9606.ENSP00000251453	0.524	Ribosomal protein S16
18	9606.ENSP00000436047	0.521	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
19	9606.ENSP00000400467	0.517	L ribosomal proteins
20	9606.ENSP00000434412	0.512	Serpin H1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016791	1.000	phosphatase activity
GO:0005488	0.772	binding
GO:0050124	0.616	N-acylneuraminate-9-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044283	0.998	small molecule biosynthetic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:1901576	0.996	organic substance biosynthetic process
GO:0044249	0.996	cellular biosynthetic process
GO:0006040	0.993	amino sugar metabolic process
GO:1901137	0.993	carbohydrate derivative biosynthetic process
GO:0043436	0.991	oxoacid metabolic process
GO:1901564	0.987	organonitrogen compound metabolic process
GO:0034641	0.986	cellular nitrogen compound metabolic process
GO:0043603	0.985	amide metabolic process
GO:1901566	0.983	organonitrogen compound biosynthetic process
GO:0043604	0.982	amide biosynthetic process
GO:0046394	0.979	carboxylic acid biosynthetic process
GO:0046349	0.970	amino sugar biosynthetic process
GO:0044238	0.379	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.886	organelle
GO:0043227	0.863	membrane-bounded organelle
GO:0043229	0.858	intracellular organelle
GO:0043231	0.843	intracellular membrane-bounded organelle
GO:0070013	0.698	intracellular organelle lumen
GO:0005634	0.688	nucleus
GO:0016020	0.452	membrane
GO:0005654	0.404	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:13057	0.616	an N-acylneuraminate 9-phosphate + H2O = an N-acylneuraminate + phosphate
EC:3.1.3.29	0.616	N-acylneuraminate-9-phosphatase.

[back to server]