StarFunc result for job id Q8TBF2

User Input

>input (198 residues)
MSTVDLARVGACILKHAVTGEAVELRSLWREHACVVAGLRRFGCVVCRWIAQDLSSLAGL
LDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGK
PVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVL
GISAEVCASDPPQCDREV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TBF2	1.000	1.000	6.808E-42	198	1.000	1.000	Q8TBF2.pdb.gz	PXL2B_HUMAN Prostamide/prostaglandin F synthase OS=Homo sapiens OX=9606 GN=PRXL2B PE=1 SV=1
2	AFDB:D3ZVR7	0.974	0.960	3.261E-37	201	0.874	0.861	D3ZVR7.pdb.gz	PXL2B_RAT Prostamide/prostaglandin F synthase OS=Rattus norvegicus OX=10116 GN=Prxl2b PE=3 SV=1
3	AFDB:A9CQL8	0.971	0.952	8.085E-37	202	0.879	0.861	A9CQL8.pdb.gz	PXL2B_PIG Prostamide/prostaglandin F synthase OS=Sus scrofa OX=9823 GN=PRXL2B PE=1 SV=1
4	AFDB:Q9BRX8	0.776	0.676	9.293E-15	229	0.303	0.262	Q9BRX8.pdb.gz	PXL2A_HUMAN Peroxiredoxin-like 2A OS=Homo sapiens OX=9606 GN=PRXL2A PE=1 SV=3
5	AFDB:Q9CYH2	0.780	0.712	1.922E-14	218	0.293	0.266	Q9CYH2.pdb.gz	PXL2A_MOUSE Peroxiredoxin-like 2A OS=Mus musculus OX=10090 GN=Prxl2a PE=1 SV=2
6	AFDB:Q9ZUU2	0.742	0.602	1.918E-13	248	0.247	0.198	Q9ZUU2.pdb.gz	PXL2C_ARATH Thioredoxin-like protein AAED1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g37240 PE=1 SV=2
7	AFDB:Q7RTV5	0.665	0.591	6.047E-12	226	0.242	0.212	Q7RTV5.pdb.gz	PXL2C_HUMAN Peroxiredoxin-like 2C OS=Homo sapiens OX=9606 GN=PRXL2C PE=2 SV=1
8	AFDB:Q8L5Y8	0.706	0.522	3.951E-11	275	0.232	0.167	Q8L5Y8.pdb.gz	Q8L5Y8_ARATH Thioredoxin superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g65840 PE=1 SV=1
9	AFDB:O53923	0.667	0.573	2.018E-8	234	0.106	0.090	O53923.pdb.gz	O53923_MYCTU Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1676 PE=1 SV=1
10	AFDB:O94561	0.612	0.620	2.273E-7	195	0.131	0.133	O94561.pdb.gz	PRX_SCHPO Peroxiredoxin bcp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bcp1 PE=1 SV=1
11	PDB:3iosA	0.543	0.773	2.014E-5	134	0.126	0.187	3iosA.pdb.gz
12	PDB:4k1fA	0.533	0.533	3.472E-5	198	0.116	0.116	4k1fA.pdb.gz
13	PDB:5dvbA	0.540	0.538	3.919E-5	199	0.111	0.111	5dvbA.pdb.gz
14	PDB:2c0dB	0.518	0.575	8.610E-5	175	0.136	0.154	2c0dB.pdb.gz
15	PDB:2r37A	0.398	0.411	1.315E-4	191	0.106	0.110	2r37A.pdb.gz
16	PDB:2z9sA	0.566	0.569	1.398E-4	197	0.091	0.091	2z9sA.pdb.gz
17	PDB:1qmvA	0.540	0.542	2.135E-4	197	0.106	0.107	1qmvA.pdb.gz
18	PDB:1xvwB	0.515	0.621	2.135E-4	160	0.126	0.156	1xvwB.pdb.gz
19	PDB:2f8aA	0.448	0.473	2.135E-4	186	0.136	0.145	2f8aA.pdb.gz
20	PDB:2i3yA	0.390	0.408	2.268E-4	188	0.111	0.117	2i3yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TBF2	3.26e-142	395	198	1.000	1.000	PXL2B_HUMAN Prostamide/prostaglandin F synthase OS=Homo sapiens OX=9606 GN=PRXL2B PE=1 SV=1
2	Q9DB60	1.41e-127	359	201	0.884	0.871	PXL2B_MOUSE Prostamide/prostaglandin F synthase OS=Mus musculus OX=10090 GN=Prxl2b PE=1 SV=1
3	D3ZVR7	4.80e-127	357	201	0.874	0.861	PXL2B_RAT Prostamide/prostaglandin F synthase OS=Rattus norvegicus OX=10116 GN=Prxl2b PE=3 SV=1
4	A9CQL8	4.47e-124	350	202	0.884	0.866	PXL2B_PIG Prostamide/prostaglandin F synthase OS=Sus scrofa OX=9823 GN=PRXL2B PE=1 SV=1
5	Q9BRX8	6.94e-17	77.8	229	0.288	0.249	PXL2A_HUMAN Peroxiredoxin-like 2A OS=Homo sapiens OX=9606 GN=PRXL2A PE=1 SV=3
6	Q9CYH2	5.29e-15	72.4	218	0.263	0.239	PXL2A_MOUSE Peroxiredoxin-like 2A OS=Mus musculus OX=10090 GN=Prxl2a PE=1 SV=2
7	Q9ZUU2	3.31e-14	70.9	248	0.253	0.202	PXL2C_ARATH Thioredoxin-like protein AAED1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g37240 PE=1 SV=2
8	Q7RTV5	1.68e-11	63.2	226	0.232	0.204	PXL2C_HUMAN Peroxiredoxin-like 2C OS=Homo sapiens OX=9606 GN=PRXL2C PE=2 SV=1
9	Q8L5Y8	7.43e-04	41.6	275	0.232	0.167	Q8L5Y8_ARATH Thioredoxin superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g65840 PE=1 SV=1
10	A0A1P8AUY4	0.28	34.3	5400	0.106	0.004	MDN1_ARATH Midasin OS=Arabidopsis thaliana OX=3702 GN=MDN1 PE=1 SV=1
11	Q389J5	3.7	30.8	729	0.071	0.019	Q389J5_TRYB2 FCP1 homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0480 PE=4 SV=1
12	Q96HA7	5.2	30.4	1378	0.101	0.015	TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens OX=9606 GN=TONSL PE=1 SV=2
13	O43027	6.4	30.0	733	0.066	0.018	RGA6_SCHPO Probable Rho-GTPase-activating protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga6 PE=1 SV=1
14	Q9XYM1	9.7	29.3	531	0.091	0.034	Q9XYM1_DROME Aspartate--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=AspRS PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00578 AhpC-TSA	1.7	20.0	AhpC/TSA family
2	PF13911 AhpC-TSA_2	6.8e-19	79.5	AhpC/TSA antioxidant enzyme
3	PF08534 Redoxin	80	14.4	Redoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000292

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000021277	0.908	Prostaglandin E synthase 2
2	61853.ENSNLEP00000008499	0.906	Prostacyclin synthase
3	61853.ENSNLEP00000021916	0.906	Prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
4	61853.ENSNLEP00000005287	0.905	Carbonyl reductase 1
5	61853.ENSNLEP00000010659	0.905	Uncharacterized protein
6	61853.ENSNLEP00000005296	0.903	Carbonyl reductase 3
7	61853.ENSNLEP00000017267	0.902	Belongs to the GST superfamily.
8	61853.ENSNLEP00000021178	0.902	Prostaglandin E synthase 3 (cytosolic)
9	61853.ENSNLEP00000023414	0.902	Uncharacterized protein
10	61853.ENSNLEP00000021423	0.900	Prostaglandin E synthase
11	61853.ENSNLEP00000013026	0.637	Family with sequence similarity 213, member A
12	61853.ENSNLEP00000018237	0.617	Methionine sulfoxide reductase A
13	61853.ENSNLEP00000000340	0.547	Coiled-coil domain containing 58
14	61853.ENSNLEP00000006664	0.547	Specifically binds 5-hydroxymethylcytosine (5hmC), suggesting that it acts as a specific reader of 5hmC.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003824	0.995	catalytic activity
GO:0016491	0.977	oxidoreductase activity
GO:0016209	0.599	antioxidant activity
GO:0016616	0.534	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0004601	0.484	peroxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901576	0.999	organic substance biosynthetic process
GO:0044249	0.998	cellular biosynthetic process
GO:0019752	0.998	carboxylic acid metabolic process
GO:0044283	0.997	small molecule biosynthetic process
GO:0046456	0.992	icosanoid biosynthetic process
GO:0006693	0.992	prostaglandin metabolic process
GO:0006636	0.992	unsaturated fatty acid biosynthetic process
GO:0001516	0.923	prostaglandin biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005737	0.990	cytoplasm
GO:0005829	0.954	cytosol
GO:0043229	0.932	intracellular organelle
GO:0043231	0.920	intracellular membrane-bounded organelle
GO:0005576	0.911	extracellular region
GO:0031982	0.791	vesicle
GO:0005615	0.725	extracellular space
GO:0043230	0.475	extracellular organelle
GO:0065010	0.445	extracellular membrane-bounded organelle
GO:0070062	0.405	extracellular exosome
GO:0012505	0.401	endomembrane system
GO:0005634	0.390	nucleus
GO:0070013	0.369	intracellular organelle lumen
GO:0031981	0.345	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.977	Oxidoreductases.
EC:1.1.1.-	0.534	With NAD(+) or NADP(+) as acceptor.
EC:1.11.1.-	0.484	Peroxidases.

[back to server]