StarFunc result for job id Q8TBF5

User Input

>input (258 residues)
MAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRD
LLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPN
YLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFP
ILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITI
LCSTLILVAVFKYGHFSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TBF5	1.000	1.000	3.364E-48	258	1.000	1.000	Q8TBF5.pdb.gz	PIGX_HUMAN Phosphatidylinositol-glycan biosynthesis class X protein OS=Homo sapiens OX=9606 GN=PIGX PE=2 SV=3
2	AFDB:Q86UK5	0.291	0.075	9.031E-4	1308	0.089	0.018	Q86UK5.pdb.gz	LBN_HUMAN Limbin OS=Homo sapiens OX=9606 GN=EVC2 PE=1 SV=1
3	AFDB:Q8K1G2	0.234	0.070	9.531E-4	1220	0.105	0.022	Q8K1G2.pdb.gz	LBN_MOUSE Limbin OS=Mus musculus OX=10090 GN=Evc2 PE=1 SV=1
4	AFDB:Q8L735	0.201	0.079	2.137E-3	882	0.105	0.031	Q8L735.pdb.gz	ISOA2_ARATH Isoamylase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISA2 PE=1 SV=2
5	AFDB:Q86UX2	0.241	0.085	2.512E-3	942	0.093	0.025	Q86UX2.pdb.gz	ITIH5_HUMAN Inter-alpha-trypsin inhibitor heavy chain H5 OS=Homo sapiens OX=9606 GN=ITIH5 PE=2 SV=2
6	AFDB:Q9W3G0	0.332	0.154	2.512E-3	633	0.074	0.030	Q9W3G0.pdb.gz	Q9W3G0_DROME Phosphatidylinositol glycan anchor biosynthesis class T OS=Drosophila melanogaster OX=7227 GN=PIG-T PE=2 SV=1
7	AFDB:Q61702	0.193	0.069	2.651E-3	907	0.081	0.023	Q61702.pdb.gz	ITIH1_MOUSE Inter-alpha-trypsin inhibitor heavy chain H1 OS=Mus musculus OX=10090 GN=Itih1 PE=1 SV=2
8	PDB:1p35A	0.202	0.181	4.685E-3	299	0.105	0.090	1p35A.pdb.gz
9	AFDB:A0A0M5L610	0.111	0.107	5.059E-3	269	0.128	0.123	A0A0M5L610.pdb.gz	A0A0M5L610_PANTR Basigin OS=Pan troglodytes OX=9598 GN=BSG PE=1 SV=1
10	PDB:1q90A	0.277	0.252	5.217E-3	292	0.101	0.089	1q90A.pdb.gz	An Atypical Haem in the Cytochrome B6F Complex
11	PDB:7w72T	0.396	0.218	6.471E-3	527	0.093	0.046	7w72T.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
12	AFDB:Q06033	0.273	0.105	8.213E-3	890	0.066	0.019	Q06033.pdb.gz	ITIH3_HUMAN Inter-alpha-trypsin inhibitor heavy chain H3 OS=Homo sapiens OX=9606 GN=ITIH3 PE=1 SV=2
13	AFDB:Q61704	0.271	0.100	8.667E-3	889	0.074	0.021	Q61704.pdb.gz	ITIH3_MOUSE Inter-alpha-trypsin inhibitor heavy chain H3 OS=Mus musculus OX=10090 GN=Itih3 PE=1 SV=3
14	PDB:4nenA	0.272	0.085	9.433E-3	1063	0.050	0.012	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
15	PDB:4lnvB	0.246	0.075	1.706E-2	1063	0.085	0.021	4lnvB.pdb.gz
16	PDB:5nzuD	0.218	0.141	2.233E-2	427	0.035	0.021	5nzuD.pdb.gz
17	PDB:4lnvA	0.245	0.060	2.624E-2	1276	0.066	0.013	4lnvA.pdb.gz
18	PDB:2xpyA	0.172	0.091	3.255E-2	628	0.089	0.037	2xpyA.pdb.gz	A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
19	PDB:6k35A	0.259	0.122	3.255E-2	640	0.054	0.022	6k35A.pdb.gz	NAG-thiazoline is a potent inhibitor of the Vibrio campbellii GH20 beta-N-Acetylglucosaminidase.
20	PDB:6u3tB	0.147	0.147	3.435E-2	253	0.085	0.087	6u3tB.pdb.gz	Structure-based discovery of a small-molecule inhibitor of methicillin-resistantStaphylococcus aureusvirulence.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TBF5	0.0	534	258	1.000	1.000	PIGX_HUMAN Phosphatidylinositol-glycan biosynthesis class X protein OS=Homo sapiens OX=9606 GN=PIGX PE=2 SV=3
2	Q9C568	0.37	33.9	210	0.097	0.119	Q9C568_ARATH Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family OS=Arabidopsis thaliana OX=3702 GN=At5g22200 PE=1 SV=1
3	P07274	2.2	30.8	126	0.074	0.151	PROF_YEAST Profilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFY1 PE=1 SV=2
4	G1NJW1	3.4	30.0	115	0.066	0.148	G1NJW1_MELGA Focal adhesion kinase targeting (FAT) domain-containing protein OS=Meleagris gallopavo OX=9103 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08320 PIG-X	1.5e-34	131.3	PIG-X / PBN1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296333

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357069	0.994	GPI mannosyltransferase 1
2	9606.ENSP00000054950	0.707	Reticulocalbin-1
3	9606.ENSP00000319739	0.655	Reticulocalbin-2
4	9606.ENSP00000279036	0.582	GPI transamidase component PIG-T
5	9606.ENSP00000347206	0.575	Glycosylphosphatidylinositol anchor attachment 1 protein
6	9606.ENSP00000281382	0.541	Phosphatidylinositol-glycan biosynthesis class F protein
7	9606.ENSP00000415203	0.536	GPI ethanolamine phosphate transferase 2
8	9606.ENSP00000363260	0.535	GPI mannosyltransferase 2
9	9606.ENSP00000282928	0.523	Zinc finger protein ZIC 1
10	9606.ENSP00000356702	0.518	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
11	9606.ENSP00000026218	0.509	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.390	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0071704	0.951	organic substance metabolic process
GO:0044238	0.911	primary metabolic process
GO:0044237	0.907	cellular metabolic process
GO:0006807	0.898	nitrogen compound metabolic process
GO:1901576	0.862	organic substance biosynthetic process
GO:0019538	0.862	protein metabolic process
GO:0044249	0.855	cellular biosynthetic process
GO:0009059	0.853	macromolecule biosynthetic process
GO:0044260	0.850	cellular macromolecule metabolic process
GO:0043412	0.839	macromolecule modification
GO:0034645	0.796	cellular macromolecule biosynthetic process
GO:0036211	0.782	protein modification process
GO:1901135	0.768	carbohydrate derivative metabolic process
GO:1901137	0.759	carbohydrate derivative biosynthetic process
GO:1901566	0.758	organonitrogen compound biosynthetic process
GO:0046488	0.753	phosphatidylinositol metabolic process
GO:0008610	0.750	lipid biosynthetic process
GO:0006664	0.676	glycolipid metabolic process
GO:0006661	0.671	phosphatidylinositol biosynthetic process
GO:0006506	0.506	GPI anchor biosynthetic process
GO:0065007	0.316	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]