StarFunc result for job id Q8TBG4

User Input

>input (499 residues)
MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHVG
HCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLAL
RLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKGKDVKKEFVHVAPTPDTYRGKYRE
DHADSASAYADEVKKIIEDAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHGAG
GVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPMGNGHPVACVVTTKEIAEAFS
SSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDI
RGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEE
DAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENPSR
KRNGMCTDTHSLLSKRLKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TBG4	1.000	1.000	1.287E-99	499	1.000	1.000	Q8TBG4.pdb.gz	AT2L1_HUMAN Ethanolamine-phosphate phospho-lyase OS=Homo sapiens OX=9606 GN=ETNPPL PE=1 SV=1
2	AFDB:Q7SY54	0.893	0.906	1.735E-76	492	0.647	0.657	Q7SY54.pdb.gz	AT2L1_DANRE Ethanolamine-phosphate phospho-lyase OS=Danio rerio OX=7955 GN=etnppl PE=2 SV=1
3	PDB:6torB	0.798	0.985	2.707E-74	404	0.806	0.995	6torB.pdb.gz	Structural characterization of human O-phosphoethanolamine phospho-lyase.
4	AFDB:Q8R1K4	0.894	0.955	1.864E-72	467	0.585	0.625	Q8R1K4.pdb.gz	AT2L2_MOUSE 5-phosphohydroxy-L-lysine phospho-lyase OS=Mus musculus OX=10090 GN=Phykpl PE=1 SV=1
5	AFDB:Q8IUZ5	0.877	0.972	6.974E-71	450	0.575	0.638	Q8IUZ5.pdb.gz	AT2L2_HUMAN 5-phosphohydroxy-L-lysine phospho-lyase OS=Homo sapiens OX=9606 GN=PHYKPL PE=1 SV=1
6	AFDB:Q9VU95	0.878	0.887	7.207E-66	494	0.503	0.508	Q9VU95.pdb.gz	AGT2L_DROME Alanine--glyoxylate aminotransferase 2-like OS=Drosophila melanogaster OX=7227 GN=CG8745 PE=2 SV=2
7	AFDB:Q940M2	0.815	0.854	4.268E-51	476	0.381	0.399	Q940M2.pdb.gz	AGT21_ARATH Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT2 PE=1 SV=1
8	AFDB:Q94AL9	0.807	0.844	1.660E-50	477	0.369	0.386	Q94AL9.pdb.gz	AGT22_ARATH Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT3 PE=1 SV=2
9	AFDB:Q9SR86	0.813	0.843	4.865E-50	481	0.373	0.387	Q9SR86.pdb.gz	AGT23_ARATH Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g08860 PE=2 SV=1
10	AFDB:Q3UEG6	0.825	0.803	3.656E-47	513	0.323	0.314	Q3UEG6.pdb.gz	AGT2_MOUSE Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Agxt2 PE=1 SV=1
11	AFDB:Q9BYV1	0.827	0.803	3.722E-46	514	0.323	0.313	Q9BYV1.pdb.gz	AGT2_HUMAN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AGXT2 PE=1 SV=1
12	PDB:1sf2A	0.785	0.915	1.594E-34	425	0.228	0.268	1sf2A.pdb.gz	Crystal structures of unbound and aminooxyacetate-bound Escherichia coli gamma-aminobutyrate aminotransferase.
13	PDB:7jh3A	0.766	0.904	6.944E-34	420	0.224	0.267	7jh3A.pdb.gz
14	PDB:5h7dA	0.765	0.771	1.717E-33	495	0.220	0.222	5h7dA.pdb.gz	Construction of novel repeat proteins with rigid and predictable structures using a shared helix method.
15	PDB:4a6tC	0.782	0.854	8.378E-33	455	0.222	0.244	4a6tC.pdb.gz	Crystal Structures of the Chromobacterium Violaceum Omega-Transaminase Reveal Major Structural Rearrangements Upon Binding of Coenzyme Plp.
16	PDB:2byjA	0.718	0.879	2.910E-32	404	0.212	0.262	2byjA.pdb.gz	Determinants of Substrate Specificity in Omega-Aminotransferases.
17	PDB:4b98A	0.725	0.816	1.682E-31	441	0.206	0.234	4b98A.pdb.gz	Structural Studies with Pseudomonas and Chromobacterium [Omega]-Aminotransferases Provide Insights Into Their Differing Substrate Specificity.
18	PDB:3ntjB	0.690	0.865	9.189E-31	393	0.194	0.247	3ntjB.pdb.gz
19	PDB:4ppmA	0.753	0.807	5.312E-30	464	0.196	0.211	4ppmA.pdb.gz	Crystal structure of the catalytic domain of PigE: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (MAP) from Serratia sp. FS14
20	PDB:4adbB	0.711	0.876	9.355E-30	401	0.218	0.272	4adbB.pdb.gz	Determination of the Structure of the Catabolic N-Succinylornithine Transaminase (Astc) from Escherichia Coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7SY54	0.0	694	492	0.637	0.646	AT2L1_DANRE Ethanolamine-phosphate phospho-lyase OS=Danio rerio OX=7955 GN=etnppl PE=2 SV=1
2	Q8IUZ5	0.0	633	450	0.577	0.640	AT2L2_HUMAN 5-phosphohydroxy-L-lysine phospho-lyase OS=Homo sapiens OX=9606 GN=PHYKPL PE=1 SV=1
3	Q8R1K4	0.0	629	467	0.573	0.612	AT2L2_MOUSE 5-phosphohydroxy-L-lysine phospho-lyase OS=Mus musculus OX=10090 GN=Phykpl PE=1 SV=1
4	Q8TBG4	0.0	1043	499	1.000	1.000	AT2L1_HUMAN Ethanolamine-phosphate phospho-lyase OS=Homo sapiens OX=9606 GN=ETNPPL PE=1 SV=1
5	Q9VU95	0.0	527	494	0.503	0.508	AGT2L_DROME Alanine--glyoxylate aminotransferase 2-like OS=Drosophila melanogaster OX=7227 GN=CG8745 PE=2 SV=2
6	Q940M2	1.54e-115	350	476	0.385	0.403	AGT21_ARATH Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT2 PE=1 SV=1
7	Q9SR86	2.27e-112	343	481	0.375	0.389	AGT23_ARATH Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g08860 PE=2 SV=1
8	Q94AL9	3.25e-109	334	477	0.369	0.386	AGT22_ARATH Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT3 PE=1 SV=2
9	Q64565	1.77e-90	287	512	0.329	0.320	AGT2_RAT Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Agxt2 PE=1 SV=2
10	Q3UEG6	8.47e-90	285	513	0.329	0.320	AGT2_MOUSE Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Agxt2 PE=1 SV=1
11	Q9BYV1	5.59e-89	283	514	0.325	0.315	AGT2_HUMAN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AGXT2 PE=1 SV=1
12	P94427	9.23e-50	178	436	0.255	0.291	GABT_BACSU Probable 4-aminobutyrate aminotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=gabT PE=3 SV=1
13	Q9I6M4	1.90e-48	174	426	0.263	0.308	DAVT_PSEAE 5-aminovalerate aminotransferase DavT OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=davT PE=1 SV=1
14	P07991	6.60e-46	167	424	0.251	0.295	OAT_YEAST Ornithine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAR2 PE=1 SV=2
15	Q9US34	1.39e-45	167	448	0.240	0.268	YFZ7_SCHPO Uncharacterized aminotransferase C1039.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1039.07c PE=3 SV=1
16	Q6FK60	1.90e-45	166	431	0.259	0.299	Q6FK60_CANGA Ornithine aminotransferase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAR2 PE=3 SV=1
17	Q88RB9	1.82e-44	163	425	0.255	0.299	DAVT_PSEPK 5-aminovalerate aminotransferase DavT OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=davT PE=1 SV=1
18	P42588	2.92e-43	161	459	0.224	0.244	PAT_ECOLI Putrescine aminotransferase OS=Escherichia coli (strain K12) OX=83333 GN=patA PE=1 SV=2
19	Q9I6J2	4.02e-43	160	456	0.267	0.292	SPUC_PSEAE Putrescine--pyruvate aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=spuC PE=1 SV=1
20	Q9FNK4	7.56e-42	157	475	0.255	0.267	OAT_ARATH Ornithine aminotransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DELTA-OAT PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00202 Aminotran_3	2e-79	278.8	Aminotransferase class-III

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296486

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000455459	0.936	Hydroxylysine kinase
2	9606.ENSP00000266517	0.924	Ethanolamine kinase 1
3	9606.ENSP00000384400	0.913	Choline/ethanolamine kinase
4	9606.ENSP00000356169	0.907	Ethanolamine kinase 2
5	9606.ENSP00000265689	0.906	Choline kinase alpha
6	9606.ENSP00000406909	0.900	Phosphoethanolamine/phosphocholine phosphatase
7	9606.ENSP00000442050	0.900	Ethanolamine-phosphate cytidylyltransferase
8	9606.ENSP00000303077	0.776	Putative aspartate aminotransferase, cytoplasmic 2
9	9606.ENSP00000370761	0.712	Electron transfer flavoprotein regulatory factor 1
10	9606.ENSP00000340914	0.696	Synaptotagmin-3
11	9606.ENSP00000474230	0.640	Ras-like protein family member 10B
12	9606.ENSP00000302620	0.615	Alanine-glyoxylate aminotransferase
13	9606.ENSP00000216127	0.608	GTP-binding protein Rhes
14	9606.ENSP00000381949	0.606	Collagen alpha-1(XIII) chain
15	9606.ENSP00000320634	0.603	Solute carrier organic anion transporter family member 3A1
16	9606.ENSP00000290949	0.596	V-type proton ATPase subunit d 1
17	9606.ENSP00000366641	0.591	Solute carrier family 2, facilitated glucose transporter member 5
18	9606.ENSP00000448059	0.577	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
19	9606.ENSP00000421048	0.573	Serine protease inhibitor Kazal-type 13
20	9606.ENSP00000385905	0.565	Deoxyribonuclease-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008483	0.998	transaminase activity
GO:0016829	0.995	lyase activity
GO:0016838	0.991	carbon-oxygen lyase activity, acting on phosphates
GO:0005488	0.990	binding
GO:0005515	0.911	protein binding
GO:0097159	0.336	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0048856	0.581	anatomical structure development
GO:0030154	0.516	cell differentiation
GO:0030097	0.468	hemopoiesis
GO:0008152	0.444	metabolic process
GO:0071704	0.434	organic substance metabolic process
GO:0032501	0.369	multicellular organismal process
GO:0007275	0.304	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0070013	0.992	intracellular organelle lumen
GO:0005759	0.603	mitochondrial matrix
GO:0005654	0.366	nucleoplasm
GO:0005829	0.312	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.6.1.-	0.998	Transaminases.
EC:4.-.-.-	0.995	Lyases.
EC:4.2.3.-	0.991	Acting on phosphates.

[back to server]