StarFunc result for job id Q8TBK2

User Input

>input (473 residues)
MATQAKRPRVAGPVDGGDLDPVACFLSWCRRVGLELSPKVSERAGGRRTRGGARAALTSP
PAQVAVSRQGTVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQS
GWVPLLLALLHELQAPASRWRPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKD
LANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPNS
PVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHEIFNTYGQMANWQLIHMYGFV
EPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGEEGAFVIGREE
VLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSV
LLTLQTYATDLKTDQGLLSNKEVYAKLSWREQQALQVRYGQKMILHQLLELTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TBK2	1.000	1.000	1.673E-81	473	1.000	1.000	Q8TBK2.pdb.gz	SETD6_HUMAN N-lysine methyltransferase SETD6 OS=Homo sapiens OX=9606 GN=SETD6 PE=1 SV=2
2	AFDB:Q9CWY3	0.926	0.926	1.370E-64	473	0.780	0.780	Q9CWY3.pdb.gz	SETD6_MOUSE N-lysine methyltransferase SETD6 OS=Mus musculus OX=10090 GN=Setd6 PE=1 SV=1
3	PDB:3qxyA	0.864	0.971	1.958E-63	420	0.884	0.995	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
4	AFDB:J3QT10	0.796	0.929	7.817E-61	404	0.850	0.995	J3QT10.pdb.gz	J3QT10_HUMAN N-lysine methyltransferase SETD6 OS=Homo sapiens OX=9606 GN=SETD6 PE=1 SV=1
5	AFDB:Q12504	0.682	0.655	3.047E-19	494	0.218	0.209	Q12504.pdb.gz	RKM4_YEAST Ribosomal lysine N-methyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RKM4 PE=1 SV=1
6	PDB:6ox1B	0.678	0.665	1.656E-18	484	0.224	0.219	6ox1B.pdb.gz	Structural basis for the target specificity of actin histidine methyltransferase SETD3.
7	AFDB:Q7SXS7	0.671	0.544	2.105E-18	596	0.224	0.178	Q7SXS7.pdb.gz	SETD3_DANRE Actin-histidine N-methyltransferase OS=Danio rerio OX=7955 GN=setd3 PE=2 SV=1
8	AFDB:G3V6U9	0.674	0.545	2.209E-18	596	0.228	0.181	G3V6U9.pdb.gz	SETD3_RAT Actin-histidine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Setd3 PE=1 SV=1
9	AFDB:Q38A07	0.652	0.659	1.454E-17	467	0.178	0.180	Q38A07.pdb.gz	Q38A07_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0660 PE=4 SV=1
10	AFDB:O42925	0.639	0.639	2.039E-17	473	0.171	0.171	O42925.pdb.gz	YBD1_SCHPO Uncharacterized protein C16C6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16C6.01c PE=4 SV=2
11	AFDB:Q9P6L2	0.642	0.649	2.039E-17	468	0.205	0.207	Q9P6L2.pdb.gz	RKM4_SCHPO Ribosomal lysine N-methyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set13 PE=3 SV=2
12	AFDB:Q9FYK3	0.679	0.675	2.140E-17	476	0.190	0.189	Q9FYK3.pdb.gz	Q9FYK3_ARATH F21J9.27 OS=Arabidopsis thaliana OX=3702 GN=At1g24610 PE=1 SV=1
13	PDB:5v3hA	0.316	0.337	8.479E-7	438	0.146	0.158	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
14	PDB:5ex0A	0.297	0.322	1.375E-6	429	0.144	0.159	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
15	PDB:3n71A	0.311	0.314	2.704E-6	468	0.129	0.130	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
16	PDB:2g46A	0.183	0.659	9.513E-3	119	0.072	0.286	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
17	PDB:7td5F	0.136	0.143	1.154E-2	447	0.036	0.038	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
18	PDB:5hynA	0.118	0.098	1.871E-2	581	0.036	0.029	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
19	PDB:7td5A	0.136	0.130	2.624E-2	497	0.036	0.034	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
20	PDB:5wg6A	0.096	0.088	3.183E-2	517	0.059	0.054	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3QT10	0.0	795	404	0.852	0.998	J3QT10_HUMAN N-lysine methyltransferase SETD6 OS=Homo sapiens OX=9606 GN=SETD6 PE=1 SV=1
2	Q8TBK2	0.0	973	473	1.000	1.000	SETD6_HUMAN N-lysine methyltransferase SETD6 OS=Homo sapiens OX=9606 GN=SETD6 PE=1 SV=2
3	Q9CWY3	0.0	708	473	0.780	0.780	SETD6_MOUSE N-lysine methyltransferase SETD6 OS=Mus musculus OX=10090 GN=Setd6 PE=1 SV=1
4	Q12504	3.53e-23	104	494	0.154	0.148	RKM4_YEAST Ribosomal lysine N-methyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RKM4 PE=1 SV=1
5	Q91WC0	3.65e-21	99.0	594	0.230	0.184	SETD3_MOUSE Actin-histidine N-methyltransferase OS=Mus musculus OX=10090 GN=Setd3 PE=1 SV=1
6	G3V6U9	3.67e-21	99.0	596	0.230	0.183	SETD3_RAT Actin-histidine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Setd3 PE=1 SV=1
7	Q86TU7	4.88e-20	95.5	594	0.226	0.180	SETD3_HUMAN Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3 PE=1 SV=1
8	Q9P6L2	3.62e-18	89.0	468	0.165	0.167	RKM4_SCHPO Ribosomal lysine N-methyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set13 PE=3 SV=2
9	Q7SXS7	5.52e-17	85.9	596	0.224	0.178	SETD3_DANRE Actin-histidine N-methyltransferase OS=Danio rerio OX=7955 GN=setd3 PE=2 SV=1
10	A0A384KCR9	3.66e-12	70.5	504	0.135	0.127	A0A384KCR9_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At3g07670 PE=1 SV=1
11	O42925	1.84e-10	65.1	473	0.142	0.142	YBD1_SCHPO Uncharacterized protein C16C6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16C6.01c PE=4 SV=2
12	Q9XI84	7.50e-08	57.0	482	0.142	0.139	RBCMT_ARATH [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LSMT-L PE=1 SV=1
13	Q9W3U1	3.03e-07	55.1	537	0.171	0.151	SETD3_DROME Actin-histidine N-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Setd3 PE=2 SV=2
14	O14135	7.43e-07	53.5	429	0.125	0.138	SET8_SCHPO SET domain-containing protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set8 PE=3 SV=1
15	O74738	3.22e-06	52.0	547	0.095	0.082	SET10_SCHPO Ribosomal lysine N-methyltransferase set10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set10 PE=3 SV=1
16	Q9NVD3	3.00e-04	45.4	440	0.129	0.139	SETD4_HUMAN SET domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SETD4 PE=1 SV=1
17	Q57UB6	3.95e-04	45.4	586	0.068	0.055	Q57UB6_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.160 PE=4 SV=1
18	P58467	6.18e-04	44.7	439	0.125	0.134	SETD4_MOUSE SET domain-containing protein 4 OS=Mus musculus OX=10090 GN=Setd4 PE=1 SV=2
19	P38222	0.002	42.7	552	0.034	0.029	RKM3_YEAST Ribosomal lysine N-methyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RKM3 PE=1 SV=1
20	Q501D3	0.002	43.1	547	0.156	0.135	Q501D3_ARATH At1g01920 OS=Arabidopsis thaliana OX=3702 GN=At1g01920 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20575 HTH_63	3.4e+02	12.3	Helix-turn-helix domain
2	PF09273 Rubis-subs-bind	2.9e-10	52.4	Rubisco LSMT substrate-binding
3	PF00856 SET	4.8e-18	77.6	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219315

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384273	0.985	Transcription factor p65
2	9606.ENSP00000358983	0.908	Nuclear factor NF-kappa-B p100 subunit
3	9606.ENSP00000226574	0.907	Nuclear factor NF-kappa-B p105 subunit
4	9606.ENSP00000382163	0.808	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
5	9606.ENSP00000274031	0.643	Histone-lysine N-methyltransferase SETD7
6	9606.ENSP00000401018	0.600	GINS complex subunit 3
7	9606.ENSP00000355133	0.593	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
8	9606.ENSP00000384629	0.590	N-lysine methyltransferase KMT5A
9	9606.ENSP00000372067	0.588	Protein arginine N-methyltransferase 8
10	9606.ENSP00000359095	0.585	Protein arginine N-methyltransferase 6
11	9606.ENSP00000263697	0.583	DnaJ homolog subfamily C member 8
12	9606.ENSP00000403536	0.577	Guanidinoacetate N-methyltransferase
13	9606.ENSP00000419184	0.573	Histone-lysine N-methyltransferase SMYD3
14	9606.ENSP00000355924	0.572	N-lysine methyltransferase SMYD2
15	9606.ENSP00000385852	0.565	SET domain-containing protein 5
16	9606.ENSP00000406162	0.558	Protein arginine N-methyltransferase 1
17	9606.ENSP00000386759	0.544	Histone-lysine N-methyltransferase SETD2
18	9606.ENSP00000331879	0.541	Protein arginine N-methyltransferase 3
19	9606.ENSP00000373354	0.537	Histone-lysine N-methyltransferase SETMAR
20	9606.ENSP00000469413	0.534	Serine/threonine-protein kinase PAK 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016279	1.000	protein-lysine N-methyltransferase activity
GO:0008134	0.994	transcription factor binding
GO:1901681	0.989	sulfur compound binding
GO:0061629	0.962	RNA polymerase II-specific DNA-binding transcription factor binding
GO:1904047	0.956	S-adenosyl-L-methionine binding
GO:0051059	0.954	NF-kappaB binding
GO:0042054	0.828	histone methyltransferase activity
GO:0018024	0.565	histone lysine N-methyltransferase activity
GO:0140938	0.305	histone H3 methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0006479	0.987	protein methylation
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0018193	0.983	peptidyl-amino acid modification
GO:0019219	0.972	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.970	regulation of gene expression
GO:0006355	0.959	regulation of DNA-templated transcription
GO:0018205	0.958	peptidyl-lysine modification
GO:0048583	0.946	regulation of response to stimulus
GO:0065009	0.818	regulation of molecular function
GO:0018022	0.810	peptidyl-lysine methylation
GO:0080134	0.790	regulation of response to stress
GO:0051090	0.764	regulation of DNA-binding transcription factor activity
GO:0044092	0.672	negative regulation of molecular function
GO:0043433	0.638	negative regulation of DNA-binding transcription factor activity
GO:0032101	0.567	regulation of response to external stimulus
GO:0031347	0.442	regulation of defense response
GO:0032088	0.435	negative regulation of NF-kappaB transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]