StarFunc result for job id Q8TBM8

User Input

>input (379 residues)
MEGNRDEAEKCVEIAREALNAGNREKAQRFLQKAEKLYPLPSARALLEIIMKNGSTAGNS
PHCRKPSGSGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAG
DEDLKKAYRKLALKFHPDKNHAPGATDAFKKIGNAYAVLSNPEKRKQYDLTGNEEQACNH
QNNGRFNFHRGCEADITPEDLFNIFFGGGFPSGSVHSFSNGRAGYSQQHQHRHSGHEREE
ERGDGGFSVFIQLMPIIVLILVSLLSQLMVSNPPYSLYPRSGTGQTIKMQTENLGVVYYV
NKDFKNEYKGMLLQKVEKSVEEDYVTNIRNNCWKERQQKTDMQYAAKVYRDDRLRRKADA
LSMDNCKELERLTSLYKGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TBM8	1.000	1.000	7.949E-57	379	1.000	1.000	Q8TBM8.pdb.gz	DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens OX=9606 GN=DNAJB14 PE=1 SV=1
2	AFDB:J3KPS0	0.582	0.546	1.303E-35	409	0.509	0.472	J3KPS0.pdb.gz	J3KPS0_HUMAN DnaJ (Hsp40) homolog, subfamily B, member 12, isoform CRA_c OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=1
3	AFDB:Q9VFP0	0.337	0.344	7.174E-29	370	0.404	0.414	Q9VFP0.pdb.gz	Q9VFP0_DROME RH07106p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3061 PE=1 SV=1
4	AFDB:Q17438	0.444	0.426	5.158E-28	401	0.396	0.374	Q17438.pdb.gz	DNJ1_CAEEL DnaJ homolog subfamily B member 1 OS=Caenorhabditis elegans OX=6239 GN=dnj-1 PE=1 SV=1
5	AFDB:O13633	0.339	0.323	8.200E-25	403	0.340	0.320	O13633.pdb.gz	YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi041 PE=1 SV=1
6	AFDB:Q9FH28	0.309	0.329	8.021E-21	354	0.272	0.291	Q9FH28.pdb.gz	DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana OX=3702 GN=ATJ49 PE=2 SV=2
7	AFDB:P48353	0.244	0.402	3.953E-8	224	0.179	0.304	P48353.pdb.gz	HLJ1_YEAST Protein HLJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HLJ1 PE=1 SV=1
8	AFDB:Q20774	0.234	0.267	8.611E-8	331	0.140	0.160	Q20774.pdb.gz	Q20774_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-13 PE=1 SV=1
9	AFDB:Q27237	0.253	0.191	2.192E-7	520	0.153	0.112	Q27237.pdb.gz	TID_DROME Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG5504 PE=1 SV=2
10	AFDB:Q9UBS3	0.245	0.396	2.698E-7	223	0.161	0.274	Q9UBS3.pdb.gz	DNJB9_HUMAN DnaJ homolog subfamily B member 9 OS=Homo sapiens OX=9606 GN=DNAJB9 PE=1 SV=1
11	PDB:6byrA	0.172	0.161	4.535E-4	405	0.092	0.086	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:2y4uA	0.137	0.123	1.469E-2	424	0.092	0.083	2y4uA.pdb.gz
13	PDB:7x3kA	0.172	0.242	2.113E-2	262	0.061	0.088	7x3kA.pdb.gz
14	PDB:5y88T	0.139	0.428	1.234E-1	107	0.061	0.215	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
15	PDB:2fi7A	0.139	0.232	2.185E-1	223	0.069	0.117	2fi7A.pdb.gz
16	PDB:4g1tB	0.140	0.127	2.983E-1	429	0.079	0.070	4g1tB.pdb.gz
17	PDB:2br9A	0.119	0.192	4.519E-1	230	0.071	0.117	2br9A.pdb.gz	Structural Basis for Protein-Protein Interactions in the 14-3-3 Protein Family.
18	PDB:4abnB	0.099	0.090	5.858E-1	426	0.077	0.068	4abnB.pdb.gz
19	PDB:6xt9D	0.126	0.120	5.858E-1	396	0.066	0.063	6xt9D.pdb.gz
20	PDB:5yqgC	0.120	0.189	8.425E-1	237	0.061	0.097	5yqgC.pdb.gz	Structural determinants controlling 14-3-3 recruitment to the endocytic adaptor Numb and dissociation of the Numb/alpha-adaptin complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TBM8	0.0	793	379	1.000	1.000	DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens OX=9606 GN=DNAJB14 PE=1 SV=1
2	Q9NXW2	1.50e-140	406	375	0.515	0.520	DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=5
3	J3KPS0	2.12e-140	407	409	0.515	0.477	J3KPS0_HUMAN DnaJ (Hsp40) homolog, subfamily B, member 12, isoform CRA_c OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=1
4	V9GYN7	9.30e-114	334	276	0.412	0.565	V9GYN7_HUMAN DnaJ heat shock protein family (Hsp40) member B12 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=1
5	Q9VFP0	1.19e-88	273	370	0.404	0.414	Q9VFP0_DROME RH07106p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3061 PE=1 SV=1
6	Q17438	5.22e-74	237	401	0.398	0.377	DNJ1_CAEEL DnaJ homolog subfamily B member 1 OS=Caenorhabditis elegans OX=6239 GN=dnj-1 PE=1 SV=1
7	V9GY70	4.92e-55	180	172	0.230	0.506	V9GY70_HUMAN DnaJ heat shock protein family (Hsp40) member B12 OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=1
8	O13633	4.16e-49	172	403	0.330	0.310	YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi041 PE=1 SV=1
9	Q9FH28	1.79e-30	121	354	0.256	0.274	DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana OX=3702 GN=ATJ49 PE=2 SV=2
10	Q7KQK3	2.41e-21	94.0	244	0.135	0.209	Q7KQK3_PLAF7 Heat shock protein DNAJ homologue Pfj4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211400 PE=4 SV=1
11	C9JUL4	7.57e-21	90.9	172	0.135	0.297	C9JUL4_HUMAN DnaJ heat shock protein family (Hsp40) member B4 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
12	Q9UDY4	5.19e-20	92.0	337	0.135	0.151	DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
13	Q20774	2.12e-19	90.1	331	0.135	0.154	Q20774_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-13 PE=1 SV=1
14	Q585V4	6.54e-19	89.7	404	0.121	0.114	Q585V4_TRYB2 Chaperone protein DnaJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.30 PE=3 SV=1
15	Q6DEJ4	1.38e-18	87.8	335	0.129	0.146	Q6DEJ4_DANRE DnaJ (Hsp40) homolog, subfamily B, member 1 OS=Danio rerio OX=7955 GN=dnajb1 PE=2 SV=1
16	O89114	4.76e-18	86.7	348	0.124	0.135	DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus OX=10090 GN=Dnajb5 PE=2 SV=1
17	Q7ZVY8	6.40e-18	85.9	337	0.129	0.145	Q7ZVY8_DANRE DnaJ homolog subfamily B member 1 OS=Danio rerio OX=7955 GN=zgc:55492 PE=1 SV=1
18	Q7ZW83	7.65e-18	84.0	237	0.153	0.245	Q7ZW83_DANRE DnaJ (Hsp40) homolog, subfamily B, member 6 OS=Danio rerio OX=7955 GN=dnajb6 PE=2 SV=1
19	M0QXK0	7.77e-18	84.7	273	0.129	0.179	M0QXK0_HUMAN DnaJ heat shock protein family (Hsp40) member B1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=2
20	O75953	9.19e-18	85.9	348	0.124	0.135	DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens OX=9606 GN=DNAJB5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	7.5e-23	91.7	DnaJ domain
2	PF09320 DUF1977	6.6e-22	89.1	Domain of unknown function (DUF1977)
3	PF00515 TPR_1	2.7e+02	12.8	Tetratricopeptide repeat
4	PF07719 TPR_2	8.2	17.9	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404381

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432083	0.916	Heat shock cognate 71 kDa protein
2	9606.ENSP00000378199	0.877	Heat shock-related 70 kDa protein 2
3	9606.ENSP00000221566	0.818	Small glutamine-rich tetratricopeptide repeat-containing protein alpha
4	9606.ENSP00000297185	0.784	Stress-70 protein, mitochondrial
5	9606.ENSP00000343746	0.728	Coronin-2A
6	9606.ENSP00000345848	0.713	Acidic leucine-rich nuclear phosphoprotein 32 family member B
7	9606.ENSP00000423602	0.692	Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
8	9606.ENSP00000318687	0.690	Heat shock protein 105 kDa
9	9606.ENSP00000296411	0.676	Methionine aminopeptidase 1
10	9606.ENSP00000302961	0.661	Heat shock protein family A member 4
11	9606.ENSP00000476767	0.647	Peptidyl-prolyl cis-trans isomerase FKBP8
12	9606.ENSP00000324173	0.645	78 kDa glucose-regulated protein
13	9606.ENSP00000326170	0.640	E3 ubiquitin-protein ligase rififylin
14	9606.ENSP00000285667	0.628	Heat shock 70 kDa protein 13
15	9606.ENSP00000304051	0.628	E3 ubiquitin-protein ligase RNF139
16	9606.ENSP00000364289	0.613	Nuclear cap-binding protein subunit 1
17	9606.ENSP00000320509	0.601	B-cell scaffold protein with ankyrin repeats
18	9606.ENSP00000310219	0.593	Heat shock 70 kDa protein 6
19	9606.ENSP00000364802	0.589	Heat shock 70 kDa protein 1A
20	9606.ENSP00000427679	0.585	Microsomal triglyceride transfer protein large subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030544	0.999	Hsp70 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0016043	0.938	cellular component organization
GO:0006458	0.908	'de novo' protein folding
GO:0051084	0.889	'de novo' post-translational protein folding
GO:0044085	0.818	cellular component biogenesis
GO:0065003	0.765	protein-containing complex assembly
GO:0061077	0.743	chaperone-mediated protein folding
GO:0050896	0.449	response to stimulus
GO:0008152	0.372	metabolic process
GO:0071704	0.353	organic substance metabolic process
GO:0006950	0.334	response to stress
GO:0044238	0.324	primary metabolic process
GO:0065007	0.300	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005783	0.999	endoplasmic reticulum
GO:0005634	0.840	nucleus
GO:0031090	0.651	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]