StarFunc result for job id Q8TBX8

User Input

>input (421 residues)
MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSIN
ELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQ
DYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
LLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
KDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEA
PVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAE
GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
A

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TBX8	1.000	1.000	8.670E-81	421	1.000	1.000	Q8TBX8.pdb.gz	PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C PE=1 SV=3
2	AFDB:B3DJ34	0.820	0.854	2.893E-57	404	0.613	0.639	B3DJ34.pdb.gz	B3DJ34_DANRE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Danio rerio OX=7955 GN=LOC560360 PE=1 SV=1
3	AFDB:P78356	0.842	0.852	4.780E-57	416	0.629	0.637	P78356.pdb.gz	PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B PE=1 SV=1
4	AFDB:P48426	0.831	0.861	6.680E-57	406	0.627	0.650	P48426.pdb.gz	PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens OX=9606 GN=PIP4K2A PE=1 SV=2
5	AFDB:A0A2R8RVI8	0.844	0.814	7.538E-54	437	0.613	0.590	A0A2R8RVI8.pdb.gz
6	AFDB:Q8SXX1	0.830	0.864	3.993E-49	404	0.475	0.495	Q8SXX1.pdb.gz	Q8SXX1_DROME Phosphatidylinositol 5-phosphate 4-kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=PIP4K PE=1 SV=1
7	PDB:6ym4A	0.741	0.966	3.282E-47	322	0.508	0.665	6ym4A.pdb.gz	Discovery and Characterization of the Potent and Highly Selective 1,7-Naphthyridine-Based Inhibitors BAY-091 and BAY-297 of the Kinase PIP4K2A.
8	PDB:1bo1A	0.707	0.908	3.085E-43	326	0.515	0.666	1bo1A.pdb.gz
9	PDB:7em5B	0.692	0.975	4.014E-42	297	0.489	0.694	7em5B.pdb.gz	The GTP responsiveness of PI5P4K beta evolved from a compromised trade-off between activity and specificity.
10	PDB:7n81B	0.683	0.927	4.115E-40	307	0.489	0.671	7n81B.pdb.gz	Pharmacological inhibition of PI5P4K alpha / beta disrupts cell energy metabolism and selectively kills p53-null tumor cells.
11	PDB:2gk9B	0.585	0.979	2.094E-36	250	0.587	0.988	2gk9B.pdb.gz
12	AFDB:Q503I3	0.672	0.514	1.189E-32	559	0.295	0.222	Q503I3.pdb.gz	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
13	AFDB:Q55GN6	0.710	0.425	1.329E-32	719	0.328	0.192	Q55GN6.pdb.gz	Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0267588 PE=1 SV=1
14	AFDB:Q0E8Y1	0.669	0.373	1.237E-31	781	0.299	0.161	Q0E8Y1.pdb.gz	Q0E8Y1_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform I OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=3
15	AFDB:A0A2R8QMJ9	0.661	0.478	2.161E-31	592	0.302	0.215	A0A2R8QMJ9.pdb.gz
16	PDB:4k2rA	0.131	0.106	6.588E-2	551	0.052	0.040	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
17	PDB:6fadC	0.176	0.197	1.029E-1	359	0.048	0.056	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
18	PDB:5n47A	0.071	0.111	1.438E-1	180	0.036	0.083	5n47A.pdb.gz
19	PDB:5ufuA	0.163	0.178	1.701E-1	369	0.038	0.043	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:8dksA	0.172	0.236	1.798E-1	283	0.064	0.095	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88370	0.0	731	420	0.952	0.955	PI42C_RAT Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Rattus norvegicus OX=10116 GN=Pip4k2c PE=1 SV=1
2	Q8TBX8	0.0	868	421	1.000	1.000	PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C PE=1 SV=3
3	P78356	2.06e-178	505	416	0.622	0.630	PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B PE=1 SV=1
4	Q80XI4	1.94e-176	500	416	0.629	0.637	PI42B_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Mus musculus OX=10090 GN=Pip4k2b PE=1 SV=1
5	O70172	1.15e-174	496	405	0.629	0.654	PI42A_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Mus musculus OX=10090 GN=Pip4k2a PE=1 SV=1
6	B3DJ34	3.10e-174	494	404	0.615	0.641	B3DJ34_DANRE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Danio rerio OX=7955 GN=LOC560360 PE=1 SV=1
7	P48426	1.18e-172	490	406	0.620	0.643	PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens OX=9606 GN=PIP4K2A PE=1 SV=2
8	Q8SXX1	2.01e-125	370	404	0.496	0.517	Q8SXX1_DROME Phosphatidylinositol 5-phosphate 4-kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=PIP4K PE=1 SV=1
9	Q55GN6	1.36e-54	194	719	0.306	0.179	Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0267588 PE=1 SV=1
10	A0A1D8PJ31	3.30e-48	177	718	0.306	0.180	A0A1D8PJ31_CANAL 1-phosphatidylinositol-4-phosphate 5-kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSS4 PE=4 SV=1
11	P38994	5.25e-48	177	779	0.311	0.168	MSS4_YEAST Phosphatidylinositol 4-phosphate 5-kinase MSS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSS4 PE=1 SV=2
12	Q503I3	1.14e-46	170	559	0.306	0.231	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
13	Q99755	6.35e-44	163	562	0.304	0.228	PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1
14	P70182	6.48e-44	162	546	0.299	0.231	PI51A_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Mus musculus OX=10090 GN=Pip5k1a PE=1 SV=2
15	A6PW57	6.52e-44	162	550	0.304	0.233	A6PW57_HUMAN Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=2
16	D3ZSI8	1.86e-43	161	546	0.299	0.231	PI51A_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Rattus norvegicus OX=10116 GN=Pip5k1a PE=1 SV=1
17	O60331	9.90e-43	161	668	0.316	0.199	PI51C_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Homo sapiens OX=9606 GN=PIP5K1C PE=1 SV=2
18	Q9W1Y2	5.19e-42	159	729	0.280	0.162	Q9W1Y2_DROME FI05352p OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=2
19	Q9W1Y3	6.44e-42	159	750	0.280	0.157	Q9W1Y3_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform E OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=3
20	O14986	7.12e-42	157	540	0.323	0.252	PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens OX=9606 GN=PIP5K1B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01504 PIP5K	2e-66	235.6	Phosphatidylinositol-4-phosphate 5-Kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347032

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000430344	0.927	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
2	9606.ENSP00000264380	0.925	1-phosphatidylinositol 3-phosphate 5-kinase
3	9606.ENSP00000466363	0.923	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
4	9606.ENSP00000479636	0.922	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
5	9606.ENSP00000360431	0.921	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
6	9606.ENSP00000266505	0.919	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
7	9606.ENSP00000345988	0.919	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1
8	9606.ENSP00000367747	0.919	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2
9	9606.ENSP00000388631	0.919	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
10	9606.ENSP00000357883	0.917	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
11	9606.ENSP00000361021	0.917	Phosphatase and tensin homolog
12	9606.ENSP00000265382	0.914	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
13	9606.ENSP00000244007	0.913	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
14	9606.ENSP00000338185	0.913	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
15	9606.ENSP00000443631	0.913	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
16	9606.ENSP00000482457	0.913	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
17	9606.ENSP00000260402	0.912	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
18	9606.ENSP00000367762	0.912	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
19	9606.ENSP00000285419	0.908	Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase
20	9606.ENSP00000381102	0.908	Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0016308	0.999	1-phosphatidylinositol-4-phosphate 5-kinase activity
GO:0046983	0.306	protein dimerization activity
GO:0042803	0.302	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0019222	0.991	regulation of metabolic process
GO:0006796	0.987	phosphate-containing compound metabolic process
GO:0010506	0.982	regulation of autophagy
GO:0046488	0.978	phosphatidylinositol metabolic process
GO:0033043	0.963	regulation of organelle organization
GO:0050790	0.960	regulation of catalytic activity
GO:0044087	0.959	regulation of cellular component biogenesis
GO:0006661	0.954	phosphatidylinositol biosynthetic process
GO:0051338	0.949	regulation of transferase activity
GO:0042325	0.943	regulation of phosphorylation
GO:0044088	0.931	regulation of vacuole organization
GO:1902115	0.929	regulation of organelle assembly
GO:0010508	0.928	positive regulation of autophagy
GO:0016241	0.922	regulation of macroautophagy
GO:0045936	0.920	negative regulation of phosphate metabolic process
GO:2000785	0.913	regulation of autophagosome assembly
GO:0016239	0.913	positive regulation of macroautophagy
GO:0046626	0.909	regulation of insulin receptor signaling pathway
GO:0046854	0.896	phosphatidylinositol phosphate biosynthetic process
GO:0043549	0.895	regulation of kinase activity
GO:0043086	0.889	negative regulation of catalytic activity
GO:0042326	0.881	negative regulation of phosphorylation
GO:0080090	0.875	regulation of primary metabolic process
GO:0051130	0.854	positive regulation of cellular component organization
GO:1900076	0.853	regulation of cellular response to insulin stimulus
GO:0033673	0.838	negative regulation of kinase activity
GO:1902117	0.833	positive regulation of organelle assembly
GO:0019216	0.790	regulation of lipid metabolic process
GO:0009968	0.727	negative regulation of signal transduction
GO:1900077	0.604	negative regulation of cellular response to insulin stimulus
GO:0045833	0.560	negative regulation of lipid metabolic process
GO:0046627	0.554	negative regulation of insulin receptor signaling pathway
GO:0050896	0.546	response to stimulus
GO:0043550	0.536	regulation of lipid kinase activity
GO:0060255	0.368	regulation of macromolecule metabolic process
GO:0051716	0.366	cellular response to stimulus
GO:0007154	0.359	cell communication
GO:0023052	0.347	signaling
GO:0007165	0.338	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.995	membrane
GO:0005886	0.994	plasma membrane
GO:0005654	0.993	nucleoplasm
GO:0012505	0.991	endomembrane system
GO:0005829	0.991	cytosol
GO:0031982	0.849	vesicle
GO:0005576	0.789	extracellular region
GO:0005773	0.594	vacuole
GO:0005776	0.466	autophagosome
GO:0070062	0.369	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14425	0.999	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ADP + H(+)
EC:2.7.1.68	0.999	1-phosphatidylinositol-4-phosphate 5-kinase.

[back to server]