StarFunc result for job id Q8TBY8

User Input

>input (1007 residues)
MKDEAGERDREVSSLNSKLLSLQLDIKNLHDVCKRQRKTLQDNQLCMEEAMNSSHDKKQA
QALAFEESEVEFGSSKQCHLRQLQQLKKKLLVLQQELEFHTEELQTSYYSLRQYQSILEK
QTSDLVLLHHHCKLKEDEVILYEEEMGNHNENTGEKLHLAQEQLALAGDKIASLERSLNL
YRDKYQSSLSNIELLECQVKMLQGELGGIMGQEPENKGDHSKVRIYTSPCMIQEHQETQK
RLSEVWQKVSQQDDLIQELRNKLACSNALVLEREKALIKLQADFASCTATHRYPPSSSEE
CEDIKKILKHLQEQKDSQCLHVEEYQNLVKDLRVELEAVSEQKRNIMKDMMKLELDLHGL
REETSAHIERKDKDITILQCRLQELQLEFTETQKLTLKKDKFLQEKDEMLQELEKKLTQV
QNSLLKKEKELEKQQCMATELEMTVKEAKQDKSKEAECKALQAEVQKLKNSLEEAKQQER
LAAQQAAQCKEEAALAGCHLEDTQRKLQKGLLLDKQKADTIQELQRELQMLQKESSMAEK
EQTSNRKRVEELSLELSEALRKLENSDKEKRQLQKTVAEQDMKMNDMLDRIKHQHREQGS
IKCKLEEDLQEATKLLEDKREQLKKSKEHEKLMEGELEALRQEFKKKDKTLKENSRKLEE
ENENLRAELQCCSTQLESSLNKYNTSQQVIQDLNKEIALQKESLMSLQAQLDKALQKEKH
YLQTTITKEAYDALSRKSAACQDDLTQALEKLNHVTSETKSLQQSLTQTQEKKAQLEEEI
IAYEERMKKLNTELRKLRGFHQESELEVHAFDKKLEEMSCQVLQWQKQHQNDLKMLAAKE
EQLREFQEEMAALKENLLEDDKEPCCLPQWSVPKDTCRLYRGNDQIMTNLEQWAKQQKVA
NEKLGNQLREQVKYIAKLSGEKDHLHSVMVHLQQENKKLKKEIEEKKMKAENTRLCTKAL
GPSRTESTQREKVCGTLGWKGLPQDMGQRMDLTKYIGMPHCPGSSYC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TBY8	1.000	1.000	0.000	1007	1.000	1.000	Q8TBY8.pdb.gz	PMFBP_HUMAN Polyamine-modulated factor 1-binding protein 1 OS=Homo sapiens OX=9606 GN=PMFBP1 PE=1 SV=3
2	AFDB:Q9WVQ0	0.202	0.199	4.891E-88	1022	0.704	0.694	Q9WVQ0.pdb.gz	PMFBP_MOUSE Polyamine-modulated factor 1-binding protein 1 OS=Mus musculus OX=10090 GN=Pmfbp1 PE=2 SV=1
3	AFDB:Q9Z221	0.198	0.203	3.163E-82	971	0.660	0.685	Q9Z221.pdb.gz	PMFBP_RAT Polyamine-modulated factor 1-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Pmfbp1 PE=2 SV=2
4	AFDB:Q06704	0.176	0.192	8.129E-4	911	0.140	0.155	Q06704.pdb.gz	IMH1_YEAST Golgin IMH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMH1 PE=1 SV=1
5	AFDB:O94986	0.096	0.065	8.164E-3	1710	0.197	0.116	O94986.pdb.gz	CE152_HUMAN Centrosomal protein of 152 kDa OS=Homo sapiens OX=9606 GN=CEP152 PE=1 SV=4
6	AFDB:Q54BP1	0.094	0.048	1.631E-2	2110	0.137	0.065	Q54BP1.pdb.gz	Q54BP1_DICDI Centrosomal protein 248 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293544 PE=4 SV=1
7	AFDB:Q8CGE5	0.140	0.132	6.028E-2	1071	0.180	0.169	Q8CGE5.pdb.gz	Q8CGE5_MOUSE Golgb1 protein (Fragment) OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
8	AFDB:O74424	0.132	0.077	7.030E-2	1837	0.170	0.093	O74424.pdb.gz	NU211_SCHPO Nucleoporin nup211 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup211 PE=1 SV=1
9	AFDB:I3ISQ9	0.096	0.059	1.115E-1	1954	0.180	0.093	I3ISQ9.pdb.gz
10	AFDB:M3TYT0	0.108	0.085	1.300E-1	1388	0.132	0.096	M3TYT0.pdb.gz	ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa OX=9823 GN=ROCK2 PE=1 SV=1
11	PDB:5datn4	0.037	0.205	9.349	135	0.015	0.111	5datn4.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
12	PDB:6qw64A	0.035	0.123	9.349	239	0.013	0.054	6qw64A.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TBY8	0.0	2006	1007	1.000	1.000	PMFBP_HUMAN Polyamine-modulated factor 1-binding protein 1 OS=Homo sapiens OX=9606 GN=PMFBP1 PE=1 SV=3
2	Q9WVQ0	0.0	1294	1022	0.707	0.697	PMFBP_MOUSE Polyamine-modulated factor 1-binding protein 1 OS=Mus musculus OX=10090 GN=Pmfbp1 PE=2 SV=1
3	Q9Z221	0.0	1190	971	0.661	0.686	PMFBP_RAT Polyamine-modulated factor 1-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Pmfbp1 PE=2 SV=2
4	G5EEV6	4.41e-08	60.1	3704	0.121	0.033	G5EEV6_CAEEL Laminin alpha OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
5	C1P640	4.49e-08	60.1	3683	0.121	0.033	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
6	Q21313	5.18e-08	60.1	3672	0.121	0.033	EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
7	C1P641	6.08e-08	59.7	3663	0.121	0.033	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
8	M9PDY5	0.38	37.4	1380	0.042	0.030	M9PDY5_DROME Girdin, isoform C OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
9	M9PE55	0.38	37.4	1346	0.042	0.031	M9PE55_DROME Girdin, isoform E OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
10	Q9VZT7	0.39	37.4	1381	0.042	0.030	Q9VZT7_DROME Girdin, isoform A OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
11	P25386	0.41	37.4	1790	0.082	0.046	USO1_YEAST Intracellular protein transport protein USO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=USO1 PE=1 SV=2
12	M9PEG0	0.45	37.0	1236	0.042	0.034	M9PEG0_DROME Girdin, isoform D OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
13	Q8SX64	0.47	37.0	1235	0.042	0.034	Q8SX64_DROME Girdin, isoform B OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
14	H2L0I4	1.5	35.4	2392	0.040	0.017	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
15	H2L0I2	1.6	35.4	2396	0.040	0.017	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
16	H2L0I3	1.6	35.0	2323	0.040	0.017	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
17	Q96MT8	3.8	33.9	703	0.053	0.075	CEP63_HUMAN Centrosomal protein of 63 kDa OS=Homo sapiens OX=9606 GN=CEP63 PE=1 SV=1
18	Q3BJY7	6.6	32.7	284	0.046	0.162	TPM_PSOOV Tropomyosin OS=Psoroptes ovis OX=83912 PE=1 SV=1
19	P06754	7.6	32.7	339	0.024	0.071	TPM1_DROME Tropomyosin-1, isoforms 9A/A/B OS=Drosophila melanogaster OX=7227 GN=Tm1 PE=1 SV=2
20	E9Q7G0	8.2	33.1	2094	0.037	0.018	NUMA1_MOUSE Nuclear mitotic apparatus protein 1 OS=Mus musculus OX=10090 GN=Numa1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16808 PKcGMP_CC	34	15.6	Coiled-coil N-terminus of cGMP-dependent protein kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000237353

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326342	0.712	ELMO domain-containing protein 2
2	9606.ENSP00000280191	0.703	Spermatogenesis-associated protein 4
3	9606.ENSP00000348496	0.687	SUN domain-containing protein 5
4	9606.ENSP00000262102	0.682	Microtubule-associated tumor suppressor 1
5	9606.ENSP00000298428	0.599	Protein transport protein Sec61 subunit alpha isoform 2
6	9606.ENSP00000360076	0.577	SH3-containing GRB2-like protein 3-interacting protein 1
7	9606.ENSP00000377123	0.562	Testis-specific gene 10 protein
8	9606.ENSP00000357256	0.561	Polyamine-modulated factor 1
9	9606.ENSP00000368572	0.560	Diamine acetyltransferase 1
10	9606.ENSP00000316782	0.505	Neuroblastoma breakpoint family member 3
11	9606.ENSP00000356989	0.501	Prefoldin subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.832	developmental process
GO:0032501	0.815	multicellular organismal process
GO:0007283	0.783	spermatogenesis
GO:0009987	0.719	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036126	0.997	sperm flagellum
GO:0005622	0.978	intracellular anatomical structure
GO:0043229	0.966	intracellular organelle
GO:0043231	0.860	intracellular membrane-bounded organelle
GO:0005737	0.851	cytoplasm
GO:0097224	0.664	sperm connecting piece
GO:0043232	0.512	intracellular non-membrane-bounded organelle
GO:0012505	0.469	endomembrane system
GO:0005634	0.458	nucleus
GO:0070013	0.421	intracellular organelle lumen
GO:0016020	0.399	membrane
GO:0005829	0.378	cytosol
GO:0031981	0.318	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]