StarFunc result for job id Q8TBY9

User Input

>input (1149 residues)
MSDAAEAPREATGENGETEMKEEEEPNPNYKEVEDPQQESKDDTIAWRESQEEERKTGEE
EGEEEGKEDKKIVMEETEEKAGEVQEKEASGIQEETTVEPQEVTASMIRLETQITDSQSI
TSGIFPKTQRGSKSKLSLQLEDAETDELLRDLSTQIEFLDLDQISPEEQQISSPERQPSG
ELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLVSSTTEDILFQK
DKSTPVYPLTMTWSFGWNSSLPVYYIREERQRVLLYVCAHTAIIYNVFRNNQYHLQGHAN
IISCLCVSEDRRWIATADKGPDCLVIIWDSFTGIPVHTIFDSCPEGNGIMAMAMTHDAKY
LATISDAEVQKVCIWKWTLAVETPACTLELPTEYGVQNYVTFNPTNNKELVSNSKTRAIY
YAWYEERDTLAHSAPLLTEKTFNKLVGKFSQSIFHLNLTQILSATMEGKLVVWDIHRPPS
SASTFLGFPYIKPCKLVHLQKEGITVLTTIDSYIVTGDIKGNIKFYDHTLSIVNWYSHLK
LGAIRTLSFSKTPATPPTEKSNYPPDCTLKGDLFVLRNFIIGTSDAAVYHLTTDGTKLEK
LFVEPKDAICAISCHPYQPLIAIGSICGMIKVWNYENKQYLFSRVFEKGLGVQSLTYNPE
GALLGAGFTEGTVYILDAMSLENESPEPFKYSRTSVTHISFSHDSQYMATADRSFTVAVY
MLVVRNGQRVWEYLARLRSHRKSIRSLLFGVYLDSNEPRLLSLGTDRLLIEYDLLRSYKD
HLEVLDIHHTDQGCYPTCMVWYPPLTRELFLLICNSGYKVKLFNATTKMCRKTLLGPAYG
SPIEQTQVLPVRSMAELQKRYLVFINRDKVGLQILPVDGNPHKTSAIVCHPNGVAGMAVS
YDGCYAFTAGGHDRSVVQWKITLSVLEAAVSLGGEDLTPFYGLLSGGREGKFYRELEDYF
YYSQLRSQGIDTMETRKVSEHICLSELPFVMRAIGFYPSEEKIDDIFNEIKFGEYVDTGK
LIDKINLPDFLKVYLNHKPPFGNTMSGIHKSFEVLGYTNSKGKKAIRREDFLRLLVTKGE
HMTEEEMLDCFASLFGLNPEGWKSEPATCSVKGSEICLEEELPDEITAEIFATEILGLTI
SEDSGQDGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1Q8Y1	0.762	0.907	0.000	963	0.373	0.445	F1Q8Y1.pdb.gz	F1Q8Y1_DANRE Cilia- and flagella-associated protein 251 isoform X1 OS=Danio rerio OX=7955 GN=wdr66 PE=4 SV=2
2	AFDB:Q8TBY9	1.000	1.000	0.000	1149	1.000	1.000	Q8TBY9.pdb.gz	CF251_HUMAN Cilia- and flagella-associated protein 251 OS=Homo sapiens OX=9606 GN=CFAP251 PE=1 SV=2
3	PDB:7mqaLQ	0.421	0.560	1.480E-29	830	0.091	0.127	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
4	PDB:7rroe	0.449	0.803	5.396E-28	610	0.088	0.166	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
5	PDB:7mqaLO	0.390	0.519	1.316E-25	819	0.090	0.126	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:7mq8LO	0.393	0.509	1.459E-25	848	0.088	0.119	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
7	PDB:7mq8LR	0.350	0.475	1.535E-25	773	0.111	0.166	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:7d5sB2	0.400	0.517	4.113E-24	851	0.091	0.123	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
9	PDB:7ajtUA	0.374	0.491	5.598E-24	834	0.091	0.126	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
10	PDB:7mq8LN	0.203	0.324	1.733E-23	671	0.079	0.136	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	AFDB:P97499	0.208	0.116	1.740E-23	2629	0.083	0.036	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
12	PDB:7ajuUL	0.393	0.545	5.366E-23	779	0.094	0.139	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:5wyjBE	0.308	0.419	6.938E-23	753	0.096	0.146	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
14	AFDB:O08653	0.243	0.137	9.478E-23	2629	0.093	0.041	O08653.pdb.gz	TEP1_RAT Telomerase protein component 1 OS=Rattus norvegicus OX=10116 GN=Tep1 PE=1 SV=1
15	AFDB:Q04724	0.108	0.155	8.306E-15	770	0.069	0.103	Q04724.pdb.gz	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
16	AFDB:Q9C0J8	0.128	0.112	4.942E-10	1336	0.068	0.058	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
17	AFDB:F4JUQ2	0.131	0.152	5.034E-8	920	0.102	0.127	F4JUQ2.pdb.gz	KCAI_ARATH KIN14B-interacting protein At4g14310 OS=Arabidopsis thaliana OX=3702 GN=At4g14310 PE=1 SV=1
18	AFDB:Q385F2	0.203	0.191	5.872E-8	1231	0.062	0.058	Q385F2.pdb.gz	Q385F2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4040 PE=3 SV=1
19	AFDB:Q7SYD5	0.209	0.192	7.212E-8	1254	0.059	0.054	Q7SYD5.pdb.gz	SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio OX=7955 GN=sec31a PE=2 SV=1
20	AFDB:O95819	0.129	0.121	5.926E-7	1239	0.076	0.070	O95819.pdb.gz	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q8Y1	0.0	885	963	0.374	0.447	F1Q8Y1_DANRE Cilia- and flagella-associated protein 251 isoform X1 OS=Danio rerio OX=7955 GN=wdr66 PE=4 SV=2
2	Q8TBY9	0.0	2389	1149	1.000	1.000	CF251_HUMAN Cilia- and flagella-associated protein 251 OS=Homo sapiens OX=9606 GN=CFAP251 PE=1 SV=2
3	Q24DE2	1.38e-130	425	996	0.248	0.286	CF251_TETTS Cilia- and flagella-associated protein 251 OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=CFAP251 PE=4 SV=2
4	Q57ZE4	3.62e-117	390	1027	0.249	0.278	Q57ZE4_TRYB2 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.250 PE=4 SV=1
5	A8IRK7	1.04e-65	241	815	0.144	0.202	CF251_CHLRE Cilia- and flagella-associated protein 251 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP251 PE=1 SV=1
6	B5MBZ0	9.77e-17	88.2	992	0.125	0.145	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
7	Q9HC35	1.08e-16	88.2	981	0.125	0.147	EMAL4_HUMAN Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
8	Q3UMY5	3.00e-16	86.7	988	0.126	0.147	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
9	Q05BV3	6.36e-12	72.8	1969	0.076	0.044	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
10	Q96KV7	4.61e-09	63.5	1748	0.080	0.053	WDR90_HUMAN WD repeat-containing protein 90 OS=Homo sapiens OX=9606 GN=WDR90 PE=1 SV=2
11	E7EXY5	7.33e-08	59.3	813	0.114	0.161	E7EXY5_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
12	A0A2R8RMY7	9.32e-08	58.9	817	0.114	0.160	A0A2R8RMY7_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
13	Q05BC3	1.00e-07	58.9	814	0.093	0.131	EMAL1_MOUSE Echinoderm microtubule-associated protein-like 1 OS=Mus musculus OX=10090 GN=Eml1 PE=1 SV=1
14	O00423	1.62e-07	58.2	815	0.094	0.133	EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3
15	E9Q5M6	5.45e-07	56.6	1843	0.093	0.058	CFA44_MOUSE Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1
16	Q6P6T4	5.81e-07	56.2	649	0.104	0.183	EMAL2_RAT Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1
17	Q32P44	1.30e-06	55.1	896	0.047	0.060	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
18	Q9VU65	3.69e-06	53.1	391	0.065	0.192	POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster OX=7227 GN=Poc1 PE=2 SV=1
19	A2CEH0	2.65e-05	50.4	490	0.043	0.100	POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio OX=7955 GN=poc1b PE=2 SV=1
20	A0A0C4DGQ7	1.08e-04	48.5	427	0.050	0.136	A0A0C4DGQ7_HUMAN EMAP like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.72	21.5	Anaphase-promoting complex subunit 4 WD40 domain
2	PF20426 NBCH_WD40	1.2e+02	12.9	Neurobeachin beta propeller domain
3	PF00400 WD40	1e-12	59.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288912

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000273390	0.919	Cilia- and flagella-associated protein 91
2	9606.ENSP00000245957	0.886	Cilia- and flagella-associated protein 61
3	9606.ENSP00000349568	0.831	Cilia and flagella associated protein 43
4	9606.ENSP00000252655	0.748	Radial spoke head protein 3 homolog
5	9606.ENSP00000347767	0.748	Serine/threonine-protein kinase Nek5
6	9606.ENSP00000374045	0.743	Dynein heavy chain 6, axonemal
7	9606.ENSP00000247219	0.733	TATA box-binding protein-like protein 2
8	9606.ENSP00000295297	0.706	Complement C1q tumor necrosis factor-related protein 7
9	9606.ENSP00000261383	0.703	Dynein heavy chain 3, axonemal
10	9606.ENSP00000295872	0.702	Spindle and centriole-associated protein 1
11	9606.ENSP00000373948	0.697	Cilia- and flagella-associated protein 69
12	9606.ENSP00000295240	0.682	Bardet-Biedl syndrome 5 protein
13	9606.ENSP00000283025	0.680	Tektin-5
14	9606.ENSP00000341071	0.678	Rho guanine nucleotide exchange factor 3
15	9606.ENSP00000372210	0.663	BET1-like protein
16	9606.ENSP00000329360	0.656	Coiled-coil domain containing 137
17	9606.ENSP00000340776	0.646	Cilia- and flagella-associated protein 65
18	9606.ENSP00000361095	0.646	Transmembrane protein 69
19	9606.ENSP00000353942	0.629	Dynein regulatory complex subunit 7
20	9606.ENSP00000352121	0.625	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007017	0.995	microtubule-based process
GO:0060285	0.962	cilium-dependent cell motility
GO:0003341	0.958	cilium movement
GO:0030317	0.951	flagellated sperm motility
GO:0032502	0.478	developmental process
GO:0048856	0.358	anatomical structure development
GO:0032501	0.355	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0097729	0.998	9+2 motile cilium
GO:0036126	0.988	sperm flagellum
GO:0005737	0.957	cytoplasm
GO:0043229	0.957	intracellular organelle
GO:0043231	0.871	intracellular membrane-bounded organelle
GO:0043228	0.803	non-membrane-bounded organelle
GO:0005634	0.779	nucleus
GO:0043232	0.740	intracellular non-membrane-bounded organelle
GO:0070013	0.593	intracellular organelle lumen
GO:0031981	0.430	nuclear lumen
GO:0005654	0.365	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]