StarFunc result for job id Q8TC05

User Input

>input (714 residues)
MPVRFKGLSEYQRNFLWKKSYLSESCNSSVGRKYPWAGLRSDQLGITKEPSFISKRRVPY
HDPQISKSLEWNGAISESNVVASPEPEAPETPKSQEAEQKDVTQERVHSLEASRVPKRTR
SHSADSRAEGASDVENNEGVTNHTPVNENVELEHSTKVLSENVDNGLDRLLRKKAGLTVV
PSYNALRNSEYQRQFVWKTSKETAPAFAANQVFHNKSQFVPPFKGNSVIHETEYKRNFKG
LSPVKEPKLRNDLRENRNLETVSPERKSNKIDDRLKLEAEMELKDLHQPKRKLTPWKHQR
LGKVNSEYRAKFLSPAQYLYKAGAWTHVKGNMPNQVKELREKAEFYRKRVQGTHFSRDHL
NQILSDSNCCWDVSSTTSSEGTVSSNIRALDLAGDPTSHKTLQKCPSTEPEEKGNIVEEQ
PQKNTTEKLGVSAPTIPVRRRLAWDTENTSEDVQKQPGEKEEEDDNEEEGDRKTGKQAFM
GEQEKLDVREKSKADKMKEGSDSSVSSEKGGRLPTPKLRELGGIQRTHHDLTTPAVGGAV
LVSPSKMKPPAPEQRKRMTSQDCLETSKNDFTKKESRAVSLLTSPAAGIKTVDPLPLRED
SEDNIHKFAEATLPVSKIPKYPTNPPGQLPSPPHVPSYWHPSRRIQGSLRDPEFQHNVGK
ARMNNLQLPQHEAFNDEDEDRLSEISARSAASSLRAFQTLARAKKRKENFWGKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TC05	1.000	1.000	1.788E-103	714	1.000	1.000	Q8TC05.pdb.gz	MDM1_HUMAN Nuclear protein MDM1 OS=Homo sapiens OX=9606 GN=MDM1 PE=1 SV=2
2	AFDB:Q9D067	0.166	0.167	6.934E-65	708	0.707	0.713	Q9D067.pdb.gz	MDM1_MOUSE Nuclear protein MDM1 OS=Mus musculus OX=10090 GN=Mdm1 PE=1 SV=2
3	AFDB:Q96JE9	0.053	0.047	2.367E-3	813	0.162	0.143	Q96JE9.pdb.gz	MAP6_HUMAN Microtubule-associated protein 6 OS=Homo sapiens OX=9606 GN=MAP6 PE=1 SV=2
4	AFDB:B6VQA5	0.059	0.048	6.506E-3	1048	0.160	0.109	B6VQA5.pdb.gz	SPT31_RAT Spermatogenesis-associated protein 31 OS=Rattus norvegicus OX=10116 GN=Spata31 PE=1 SV=1
5	AFDB:Q94548	0.063	0.042	2.162E-2	1150	0.132	0.082	Q94548.pdb.gz	Q94548_DROME LK6 protein kinase OS=Drosophila melanogaster OX=7227 GN=Lk6 PE=2 SV=1
6	AFDB:A6NDB9	0.044	0.046	7.651E-2	673	0.134	0.143	A6NDB9.pdb.gz	PALM3_HUMAN Paralemmin-3 OS=Homo sapiens OX=9606 GN=PALM3 PE=1 SV=2
7	AFDB:A0A1D8PMD1	0.060	0.065	1.351E-1	659	0.125	0.135	A0A1D8PMD1.pdb.gz	A0A1D8PMD1_CANAL Phosphate-sensing transcription factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO4 PE=4 SV=1
8	AFDB:Q3UHX0	0.046	0.030	2.542E-1	1147	0.134	0.084	Q3UHX0.pdb.gz	NOL8_MOUSE Nucleolar protein 8 OS=Mus musculus OX=10090 GN=Nol8 PE=1 SV=2
9	AFDB:Q965S4	0.046	0.033	3.956E-1	1126	0.172	0.109	Q965S4.pdb.gz	Q965S4_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rga-4 PE=1 SV=3
10	AFDB:G5EFL5	0.052	0.030	4.214E-1	1424	0.133	0.067	G5EFL5.pdb.gz	G5EFL5_CAEEL PDZ and LIM domain protein Zasp OS=Caenorhabditis elegans OX=6239 GN=alp-1 PE=1 SV=1
11	PDB:7mqaNA	0.052	0.102	3.514	295	0.042	0.102	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6uxvH	0.039	0.084	5.135	257	0.014	0.039	6uxvH.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
13	PDB:7ohte	0.034	0.297	9.068	39	0.011	0.205	7ohte.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TC05	0.0	1474	714	1.000	1.000	MDM1_HUMAN Nuclear protein MDM1 OS=Homo sapiens OX=9606 GN=MDM1 PE=1 SV=2
2	Q9D067	0.0	946	708	0.707	0.713	MDM1_MOUSE Nuclear protein MDM1 OS=Mus musculus OX=10090 GN=Mdm1 PE=1 SV=2
3	Q5E913	0.96	35.0	628	0.035	0.040	KN10B_ARATH Kinesin-like protein KIN-10B OS=Arabidopsis thaliana OX=3702 GN=KIN10B PE=2 SV=1
4	M9PB32	1.5	35.0	19560	0.081	0.003	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
5	M9PC41	1.5	34.7	22743	0.081	0.003	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
6	M9PB30	1.6	34.7	22949	0.081	0.003	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
7	M9PBZ0	1.6	34.7	22830	0.081	0.003	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PC45	1.6	34.7	22300	0.081	0.003	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PBZ4	1.8	34.7	18014	0.081	0.003	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PEI1	1.9	34.7	21657	0.081	0.003	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PEH5	2.2	34.3	20710	0.081	0.003	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PB31	2.8	33.9	20404	0.081	0.003	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	Q02455	3.8	33.5	1875	0.038	0.014	MLP1_YEAST Protein MLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLP1 PE=1 SV=2
14	O41928	4.0	33.5	1103	0.035	0.023	O41928_MHV68 Major DNA-binding protein OS=Murid herpesvirus 4 OX=33708 GN=GAMMAHV.ORF6 PE=1 SV=1
15	Q7TSJ2	8.8	32.3	906	0.034	0.026	MAP6_MOUSE Microtubule-associated protein 6 OS=Mus musculus OX=10090 GN=Map6 PE=1 SV=2
16	Q5CZC0	9.4	32.3	6907	0.053	0.006	FSIP2_HUMAN Fibrous sheath-interacting protein 2 OS=Homo sapiens OX=9606 GN=FSIP2 PE=2 SV=4
17	P31111	9.8	32.0	875	0.027	0.022	ZIP1_YEAST Synaptonemal complex protein ZIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZIP1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15501 MDM1	1.2e-217	736.1	Nuclear protein MDM1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302537

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381089	0.798	Solute carrier family 35 member E3
2	9606.ENSP00000342105	0.748	Dual specificity tyrosine-phosphorylation-regulated kinase 2
3	9606.ENSP00000284617	0.693	Centriole, cilia and spindle-associated protein
4	9606.ENSP00000403310	0.660	Small nuclear ribonucleoprotein U11/U12 subunit 35
5	9606.ENSP00000382390	0.649	Neuralized-like protein 4
6	9606.ENSP00000228641	0.647	Myogenic factor 6
7	9606.ENSP00000262302	0.646	Cytosolic Fe-S cluster assembly factor NUBP2
8	9606.ENSP00000433757	0.639	Tetratricopeptide repeat domain containing
9	9606.ENSP00000250076	0.623	Zinc finger protein 232
10	9606.ENSP00000265909	0.620	Sorting nexin-19
11	9606.ENSP00000313121	0.605	Sorting nexin-14
12	9606.ENSP00000392318	0.540	Cysteine-rich protein 2-binding protein
13	9606.ENSP00000426255	0.536	Sorting nexin-25
14	9606.ENSP00000356150	0.535	Protein Mdm4
15	9606.ENSP00000229179	0.528	Nuclear pore complex protein Nup107
16	9606.ENSP00000398789	0.526	Sorting nexin-13
17	9606.ENSP00000258149	0.517	E3 ubiquitin-protein ligase Mdm2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0048523	0.965	negative regulation of cellular process
GO:0044087	0.946	regulation of cellular component biogenesis
GO:1902115	0.942	regulation of organelle assembly
GO:0010639	0.908	negative regulation of organelle organization
GO:0010824	0.837	regulation of centrosome duplication
GO:1902116	0.817	negative regulation of organelle assembly
GO:0045786	0.748	negative regulation of cell cycle
GO:0010948	0.722	negative regulation of cell cycle process
GO:0009987	0.712	cellular process
GO:0051494	0.675	negative regulation of cytoskeleton organization
GO:0046599	0.321	regulation of centriole replication
GO:0046600	0.306	negative regulation of centriole replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005814	1.000	centriole
GO:0005813	1.000	centrosome
GO:0005634	0.999	nucleus
GO:0005829	0.998	cytosol
GO:0034451	0.896	centriolar satellite
GO:0031981	0.341	nuclear lumen
GO:0012505	0.312	endomembrane system
GO:0005654	0.311	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]