StarFunc result for job id Q8TC59

User Input

>input (973 residues)
MDPFRPSFRGQSPIHPSQCQAVRMPGCWPQASKPLDPALGRGAPAGRGHVFGKPEEPSTQ
RGPAQRESVGLVSMFRGLGIETVSKTPLKREMLPSGRGILGRGLSANLVRKDREELSPTF
WDPKVLAAGDSKMAETSVGWSRTLGRGSSDASLLPLGRAAGGISREVDKPPCTFSTPSRG
PPQLSSPPALPQSPLHSPDRPLVLTVEHKEKELIVKQGSKGTPQSLGLNLVKIQCHNEAV
YQYHVTFSPNVECKSMRFGMLKDHQAVTGNVTAFDGSILYLPVKLQQVLELKSQRKTDSA
EISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIW
PGYAASIRRTDGGLFLLADVSHKVIRNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVIT
RYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQ
DNHGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIA
KNEAATNELMRWGLRLQKDVHKIEGRVLPMERINLKNTSFITSQELNWVKEVTRDPSILT
IPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYVRTIQSTL
GAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQ
INCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMP
HQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAF
ENYQPKMVVFVVQKKISTNLYLAAPQNFVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGC
GIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHH
EPAIQLCENLFFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CDG1	0.803	0.805	0.000	971	0.879	0.881	Q8CDG1.pdb.gz	PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus OX=10090 GN=Piwil2 PE=1 SV=2
2	AFDB:Q8TC59	1.000	1.000	0.000	973	1.000	1.000	Q8TC59.pdb.gz	PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens OX=9606 GN=PIWIL2 PE=1 SV=1
3	AFDB:Q9JMB7	0.769	0.867	4.717E-103	862	0.345	0.390	Q9JMB7.pdb.gz	PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus OX=10090 GN=Piwil1 PE=1 SV=1
4	AFDB:Q8UVX0	0.759	0.859	7.754E-101	858	0.350	0.397	Q8UVX0.pdb.gz	PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio OX=7955 GN=piwil1 PE=1 SV=1
5	AFDB:A9ZSZ2	0.763	0.801	9.634E-101	926	0.331	0.348	A9ZSZ2.pdb.gz	AGO3_BOMMO Piwi-like protein Ago3 OS=Bombyx mori OX=7091 GN=AGO3 PE=1 SV=2
6	AFDB:A8D8P8	0.760	0.821	1.516E-89	899	0.299	0.324	A8D8P8.pdb.gz	SIWI_BOMMO Piwi-like protein Siwi OS=Bombyx mori OX=7091 GN=Siwi PE=1 SV=1
7	AFDB:P90786	0.734	0.861	5.541E-84	824	0.245	0.289	P90786.pdb.gz	P90786_CAEEL Piwi-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=prg-1 PE=1 SV=1
8	PDB:5guhA	0.720	0.914	8.407E-84	759	0.274	0.352	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
9	PDB:6kr6A	0.649	0.867	2.187E-75	713	0.240	0.328	6kr6A.pdb.gz	Crystal structure of Drosophila Piwi.
10	AFDB:Q7KWS3	0.683	0.679	2.581E-72	979	0.268	0.267	Q7KWS3.pdb.gz	Q7KWS3_DICDI Argonaut-like protein OS=Dictyostelium discoideum OX=44689 GN=agnA PE=3 SV=1
11	PDB:4krfA	0.621	0.730	1.021E-56	817	0.175	0.208	4krfA.pdb.gz	The making of a slicer: activation of human argonaute-1.
12	PDB:6oonA	0.611	0.745	2.183E-56	785	0.174	0.215	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
13	PDB:4w5tA	0.625	0.741	2.434E-56	807	0.173	0.208	4w5tA.pdb.gz	Gene regulation. Structural basis for microRNA targeting.
14	AFDB:Q9VUQ5	0.599	0.490	2.697E-55	1214	0.233	0.187	Q9VUQ5.pdb.gz	AGO2_DROME Protein argonaute-2 OS=Drosophila melanogaster OX=7227 GN=AGO2 PE=1 SV=3
15	AFDB:Q9SHF2	0.611	0.508	9.478E-53	1194	0.217	0.177	Q9SHF2.pdb.gz	AGO3_ARATH Protein argonaute 3 OS=Arabidopsis thaliana OX=3702 GN=AGO3 PE=3 SV=1
16	PDB:5weaA	0.607	0.759	1.603E-52	764	0.173	0.220	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
17	PDB:5vm9C	0.631	0.767	2.758E-52	785	0.179	0.222	5vm9C.pdb.gz	Human Argonaute3 has slicer activity.
18	PDB:7swfA	0.568	0.700	7.451E-48	778	0.175	0.219	7swfA.pdb.gz	The molecular mechanism of microRNA duplex selectivity of Arabidopsis ARGONAUTE10.
19	PDB:7kpvD	0.401	0.437	2.095E-14	876	0.087	0.097	7kpvD.pdb.gz
20	PDB:8dgaA	0.090	0.061	1.403E-6	1629	0.054	0.033	8dgaA.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VKG8	0.0	570	852	0.308	0.352	A0A140VKG8_HUMAN Piwi-like 4 (Drosophila), isoform CRA_a OS=Homo sapiens OX=9606 GN=PIWIL4 PE=2 SV=1
2	A2CEI6	0.0	1118	1046	0.561	0.522	PIWL2_DANRE Piwi-like protein 2 OS=Danio rerio OX=7955 GN=piwil2 PE=1 SV=2
3	A8KBF3	0.0	1231	949	0.635	0.651	PIWL2_XENTR Piwi-like protein 2 OS=Xenopus tropicalis OX=8364 GN=piwil2 PE=1 SV=1
4	A9ZSZ2	0.0	623	926	0.314	0.330	AGO3_BOMMO Piwi-like protein Ago3 OS=Bombyx mori OX=7091 GN=AGO3 PE=1 SV=2
5	Q4G033	0.0	573	848	0.305	0.350	PIWL4_RAT Piwi-like protein 4 OS=Rattus norvegicus OX=10116 GN=Piwil4 PE=2 SV=2
6	Q7PLK0	0.0	558	867	0.294	0.330	AGO3_DROME Protein argonaute-3 OS=Drosophila melanogaster OX=7227 GN=AGO3 PE=1 SV=3
7	Q7Z3Z4	0.0	570	852	0.308	0.352	PIWL4_HUMAN Piwi-like protein 4 OS=Homo sapiens OX=9606 GN=PIWIL4 PE=1 SV=2
8	Q8CDG1	0.0	1791	971	0.880	0.882	PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus OX=10090 GN=Piwil2 PE=1 SV=2
9	Q8CGT6	0.0	583	848	0.314	0.361	PIWL4_MOUSE Piwi-like protein 4 OS=Mus musculus OX=10090 GN=Piwil4 PE=1 SV=3
10	Q8TC59	0.0	2025	973	1.000	1.000	PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens OX=9606 GN=PIWIL2 PE=1 SV=1
11	Q8UVX0	0.0	656	858	0.329	0.373	PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio OX=7955 GN=piwil1 PE=1 SV=1
12	Q96J94	0.0	689	861	0.334	0.377	PIWL1_HUMAN Piwi-like protein 1 OS=Homo sapiens OX=9606 GN=PIWIL1 PE=1 SV=1
13	Q9JMB7	0.0	683	862	0.334	0.377	PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus OX=10090 GN=Piwil1 PE=1 SV=1
14	Q7Z3Z3	1.01e-170	523	882	0.283	0.312	PIWL3_HUMAN Piwi-like protein 3 OS=Homo sapiens OX=9606 GN=PIWIL3 PE=2 SV=2
15	A8D8P8	7.05e-162	500	899	0.274	0.297	SIWI_BOMMO Piwi-like protein Siwi OS=Bombyx mori OX=7091 GN=Siwi PE=1 SV=1
16	Q9VKM1	4.62e-148	462	843	0.262	0.302	PIWI_DROME Protein piwi OS=Drosophila melanogaster OX=7227 GN=piwi PE=1 SV=1
17	O76922	1.38e-146	459	866	0.267	0.300	AUB_DROME Protein aubergine OS=Drosophila melanogaster OX=7227 GN=aub PE=1 SV=1
18	P90786	3.83e-129	412	824	0.256	0.302	P90786_CAEEL Piwi-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=prg-1 PE=1 SV=1
19	Q54G64	1.28e-113	373	900	0.248	0.268	Q54G64_DICDI Argonaut-like protein OS=Dictyostelium discoideum OX=44689 GN=agnB PE=4 SV=1
20	Q7KWS3	3.22e-101	341	979	0.256	0.254	Q7KWS3_DICDI Argonaut-like protein OS=Dictyostelium discoideum OX=44689 GN=agnA PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08699 ArgoL1	5e-05	34.2	Argonaute linker 1 domain
2	PF02170 PAZ	3.1e-30	116.5	PAZ domain
3	PF02171 Piwi	2.4e-80	281.6	Piwi domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349208

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251864	0.999	Tudor domain-containing protein 1
2	9606.ENSP00000335153	0.984	Heat shock protein HSP 90-alpha
3	9606.ENSP00000262794	0.980	RNA helicase Mov10l1
4	9606.ENSP00000359049	0.976	Small RNA 2'-O-methyltransferase
5	9606.ENSP00000387303	0.960	ATP-dependent RNA helicase TDRD9
6	9606.ENSP00000424838	0.960	Probable ATP-dependent RNA helicase DDX4
7	9606.ENSP00000252037	0.957	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
8	9606.ENSP00000390621	0.946	Putative ATP-dependent RNA helicase TDRD12
9	9606.ENSP00000356846	0.932	Protein maelstrom homolog
10	9606.ENSP00000357812	0.927	Tudor and KH domain-containing protein
11	9606.ENSP00000284629	0.926	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
12	9606.ENSP00000346065	0.926	Tudor domain-containing protein 6
13	9606.ENSP00000255324	0.907	RING finger protein 17
14	9606.ENSP00000264657	0.905	Signal transducer and activator of transcription 3
15	9606.ENSP00000415056	0.866	piRNA biogenesis protein EXD1
16	9606.ENSP00000347444	0.827	Tudor domain-containing protein 7
17	9606.ENSP00000389395	0.826	Glycerol-3-phosphate acyltransferase 2, mitochondrial
18	9606.ENSP00000369786	0.822	Pirin
19	9606.ENSP00000406052	0.785	Tudor domain-containing protein 5
20	9606.ENSP00000437256	0.774	Endoribonuclease Dicer

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0061980	0.998	regulatory RNA binding
GO:0034584	0.992	piRNA binding
GO:0003824	0.838	catalytic activity
GO:0016788	0.695	hydrolase activity, acting on ester bonds
GO:0004521	0.409	RNA endonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.965	cellular process
GO:0048519	0.947	negative regulation of biological process
GO:0050794	0.946	regulation of cellular process
GO:0019222	0.802	regulation of metabolic process
GO:0010468	0.785	regulation of gene expression
GO:0032501	0.682	multicellular organismal process
GO:0046483	0.661	heterocycle metabolic process
GO:0006725	0.661	cellular aromatic compound metabolic process
GO:0042752	0.656	regulation of circadian rhythm
GO:0006139	0.651	nucleobase-containing compound metabolic process
GO:0048523	0.639	negative regulation of cellular process
GO:0090304	0.633	nucleic acid metabolic process
GO:0009892	0.596	negative regulation of metabolic process
GO:0010605	0.574	negative regulation of macromolecule metabolic process
GO:0032502	0.517	developmental process
GO:0016070	0.508	RNA metabolic process
GO:0010629	0.464	negative regulation of gene expression
GO:0010467	0.396	gene expression
GO:0031047	0.356	RNA-mediated gene silencing
GO:0022414	0.340	reproductive process
GO:0034660	0.315	ncRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0005829	0.986	cytosol
GO:0032991	0.951	protein-containing complex
GO:0099080	0.950	supramolecular complex
GO:0036464	0.918	cytoplasmic ribonucleoprotein granule
GO:0070013	0.771	intracellular organelle lumen
GO:0031981	0.695	nuclear lumen
GO:0005654	0.437	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.695	Acting on ester bonds.

[back to server]