StarFunc result for job id Q8TC84

User Input

>input (345 residues)
MEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYG
IIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSV
NDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDS
LMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVD
TGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDK
GADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TC84	1.000	1.000	4.162E-64	345	1.000	1.000	Q8TC84.pdb.gz	FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens OX=9606 GN=FANK1 PE=1 SV=3
2	AFDB:Q9DAM9	0.928	0.931	1.359E-58	344	0.884	0.887	Q9DAM9.pdb.gz	FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus OX=10090 GN=Fank1 PE=1 SV=1
3	AFDB:A7YY95	0.794	0.759	2.818E-42	362	0.522	0.497	A7YY95.pdb.gz
4	AFDB:G5EFS1	0.516	0.308	1.608E-17	597	0.197	0.114	G5EFS1.pdb.gz	G5EFS1_CAEEL Death domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ikb-1 PE=1 SV=1
5	AFDB:Q7T163	0.606	0.129	5.577E-17	1680	0.188	0.039	Q7T163.pdb.gz	KDISB_DANRE Kinase D-interacting substrate of 220 kDa B OS=Danio rerio OX=7955 GN=kidins220b PE=1 SV=3
6	AFDB:C7B178	0.322	0.228	8.891E-17	535	0.238	0.153	C7B178.pdb.gz	VPY_PETHY Protein VAPYRIN OS=Petunia hybrida OX=4102 GN=VPY PE=2 SV=1
7	AFDB:Q8CGB3	0.629	0.158	1.094E-16	1411	0.191	0.047	Q8CGB3.pdb.gz	UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus OX=10090 GN=Uaca PE=1 SV=2
8	AFDB:E9Q9B7	0.601	0.120	2.380E-16	1793	0.200	0.038	E9Q9B7.pdb.gz	E9Q9B7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
9	AFDB:Q9BZF9	0.630	0.157	2.928E-16	1416	0.186	0.045	Q9BZF9.pdb.gz	UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=2
10	AFDB:A1DRY3	0.626	0.282	3.248E-16	782	0.186	0.082	A1DRY3.pdb.gz	A1DRY3_HUMAN Several ankyrin repeat protein transcript variant 2 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
11	PDB:8cs9A	0.616	0.270	1.761E-14	796	0.188	0.082	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:4oauC	0.569	0.295	5.506E-14	692	0.212	0.105	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
13	PDB:2dvwA	0.576	0.846	4.746E-12	229	0.180	0.271	2dvwA.pdb.gz
14	PDB:1wg0A	0.557	0.775	1.923E-11	243	0.157	0.222	1wg0A.pdb.gz
15	PDB:6jd6B	0.367	0.581	8.206E-11	192	0.157	0.281	6jd6B.pdb.gz
16	PDB:5vkqA	0.599	0.143	1.308E-10	1499	0.174	0.040	5vkqA.pdb.gz
17	PDB:6v9hC	0.517	0.652	1.695E-10	270	0.197	0.252	6v9hC.pdb.gz
18	PDB:6aunA	0.396	0.251	1.936E-9	618	0.165	0.092	6aunA.pdb.gz
19	PDB:6mwqA	0.409	0.289	4.213E-9	493	0.162	0.114	6mwqA.pdb.gz
20	PDB:1bd8A	0.404	0.844	4.569E-8	156	0.130	0.288	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TC84	0.0	716	345	1.000	1.000	FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens OX=9606 GN=FANK1 PE=1 SV=3
2	Q9DAM9	0.0	646	344	0.884	0.887	FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus OX=10090 GN=Fank1 PE=1 SV=1
3	F6NQ86	3.08e-122	357	336	0.513	0.527	F6NQ86_DANRE Fibronectin type III and ankyrin repeat domains 1 OS=Danio rerio OX=7955 GN=fank1 PE=4 SV=1
4	Q8N8A2	2.04e-26	112	993	0.203	0.070	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
5	Q9VCA8	1.06e-25	110	4001	0.200	0.017	ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster OX=7227 GN=mask PE=1 SV=2
6	O70511	4.29e-25	108	2622	0.200	0.026	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
7	A0A5F9ZHF7	6.10e-25	108	3862	0.209	0.019	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
8	A0A5F9ZHT4	6.39e-25	108	3870	0.209	0.019	A0A5F9ZHT4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
9	Q12955	6.39e-25	108	4377	0.197	0.016	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
10	A0A5F9ZHT8	6.64e-25	108	3891	0.209	0.019	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
11	G5E8K5	6.72e-25	108	1961	0.180	0.032	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
12	F1M5N3	6.90e-25	108	3966	0.209	0.018	F1M5N3_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
13	A0A5F9ZI46	6.96e-25	108	3882	0.209	0.019	A0A5F9ZI46_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	O75179	1.23e-24	107	2603	0.212	0.028	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
15	H0YM23	1.24e-24	107	2487	0.212	0.029	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1
16	Q8N6D5	1.55e-24	103	301	0.209	0.239	ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ANKRD29 PE=1 SV=2
17	A0A5F9ZHE2	1.71e-24	107	1806	0.209	0.040	A0A5F9ZHE2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZHN0	1.78e-24	107	1777	0.209	0.041	A0A5F9ZHN0_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	Q99NH0	1.91e-24	107	2603	0.212	0.028	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
20	A0A5F9ZH03	1.96e-24	107	1785	0.209	0.040	A0A5F9ZH03_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.9e-32	120.5	Ankyrin repeat
2	PF12796 Ank_2	4.5e-33	125.0	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	6.5e-24	92.3	Ankyrin repeat
4	PF13637 Ank_4	9.6e-33	123.4	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2e-29	112.5	Ankyrin repeats (many copies)
6	PF00041 fn3	85	14.9	Fibronectin type III domain
7	PF10179 NDNF	4.6e+02	12.3	Neuron-derived neurotrophic factor, first Fn(III) domain
8	PF16656 Pur_ac_phosph_N	1.4e+02	14.6	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357682

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350512	0.789	COP9 signalosome complex subunit 5
2	9606.ENSP00000284690	0.757	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32
3	9606.ENSP00000280191	0.738	Spermatogenesis-associated protein 4
4	9606.ENSP00000253401	0.684	Rho guanine nucleotide exchange factor 9
5	9606.ENSP00000368917	0.674	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
6	9606.ENSP00000356917	0.657	Olfactomedin-like protein 2B
7	9606.ENSP00000333300	0.641	17-beta-hydroxysteroid dehydrogenase 13
8	9606.ENSP00000419494	0.622	RING1 and YY1-binding protein
9	9606.ENSP00000283928	0.617	Juxtaposed with another zinc finger protein 1
10	9606.ENSP00000376910	0.604	Leucine rich repeats and IQ motif containing 1
11	9606.ENSP00000355078	0.588	Coiled-coil domain-containing protein 7
12	9606.ENSP00000364165	0.588	Coiled-coil domain containing 7
13	9606.ENSP00000339449	0.581	Cilia- and flagella-associated protein 52
14	9606.ENSP00000376708	0.569	Von Willebrand factor A domain containing 2
15	9606.ENSP00000219299	0.556	Coiled-coil domain-containing protein 113
16	9606.ENSP00000417581	0.543	Protein FAM199X
17	9606.ENSP00000437041	0.540	NADH-cytochrome b5 reductase 2
18	9606.ENSP00000346839	0.535	Fibronectin type III domain containing
19	9606.ENSP00000331044	0.524	Enkurin
20	9606.ENSP00000338532	0.520	Protein FAM53B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0048518	0.877	positive regulation of biological process
GO:0019222	0.853	regulation of metabolic process
GO:0060255	0.822	regulation of macromolecule metabolic process
GO:0048522	0.817	positive regulation of cellular process
GO:0080090	0.812	regulation of primary metabolic process
GO:0031323	0.806	regulation of cellular metabolic process
GO:0051171	0.805	regulation of nitrogen compound metabolic process
GO:0009987	0.795	cellular process
GO:0010468	0.778	regulation of gene expression
GO:0009889	0.769	regulation of biosynthetic process
GO:0031326	0.758	regulation of cellular biosynthetic process
GO:0019219	0.730	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.712	regulation of RNA metabolic process
GO:0009893	0.701	positive regulation of metabolic process
GO:0010556	0.671	regulation of macromolecule biosynthetic process
GO:0006355	0.596	regulation of DNA-templated transcription
GO:0031325	0.514	positive regulation of cellular metabolic process
GO:0048519	0.512	negative regulation of biological process
GO:0010941	0.476	regulation of cell death
GO:0048523	0.461	negative regulation of cellular process
GO:0044093	0.433	positive regulation of molecular function
GO:0043067	0.384	regulation of programmed cell death
GO:0051090	0.338	regulation of DNA-binding transcription factor activity
GO:0010604	0.329	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005737	0.980	cytoplasm
GO:0070013	0.972	intracellular organelle lumen
GO:0005829	0.965	cytosol
GO:0005634	0.964	nucleus
GO:0031981	0.923	nuclear lumen
GO:0005654	0.914	nucleoplasm
GO:0005856	0.725	cytoskeleton
GO:0120025	0.485	plasma membrane bounded cell projection
GO:0016020	0.359	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]