StarFunc result for job id Q8TC90

User Input

>input (406 residues)
MTQTLDTREDPLNLGGGGGGGCGCGWAHSASLSSWSSCHRRRPGAPAYNRPHRYSPKTEY
GPPRKQPKQQHGPGFWFQPPVCSNWGCWGGPWRPPPPGFWKFPCPVQVFRVYGLHPLCFC
CCSCWSGSWNPGWVKPPGRKKRWGRRGRGLRHHPRHSYPRSPPADVSTLPRPVKLYEWRE
PGMRAPPNTTQFIMNQIYEDMRQQEKVERQQEALRAQKATVSGEASPARSSGNDAPPGGS
KETWGLQETLYGFVQNPSLAFSPNPEENQSLAPLLVEEEEEKKNDDEEEYDQEVCDAKEA
SEEEEEVEDEEEEVEDEEEEEVEEAEYVEEGEEELEEEELEEEEEVLEENEQRGEEFHLP
LEMPLSIFVEAEEKRENFISCTFLNPEQIIPKVPQESLFMAQDFNC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TC90	1.000	1.000	4.504E-67	406	1.000	1.000	Q8TC90.pdb.gz	CCER1_HUMAN Coiled-coil domain-containing glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=CCER1 PE=1 SV=1
2	AFDB:Q38CA7	0.070	0.050	5.619E-2	602	0.126	0.085	Q38CA7.pdb.gz	Q38CA7_TRYB2 SH3 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6730 PE=4 SV=1
3	AFDB:Q12416	0.081	0.098	7.366E-2	295	0.126	0.173	Q12416.pdb.gz	WHI5_YEAST G1-specific transcriptional repressor WHI5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=WHI5 PE=1 SV=1
4	AFDB:Q8IL16	0.085	0.096	1.183E-1	351	0.103	0.120	Q8IL16.pdb.gz	Q8IL16_PLAF7 Btz domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1445700 PE=4 SV=1
5	AFDB:P42283	0.131	0.069	1.354E-1	891	0.133	0.061	P42283.pdb.gz	LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=2
6	AFDB:Q9UK53	0.094	0.091	1.449E-1	422	0.138	0.133	Q9UK53.pdb.gz	ING1_HUMAN Inhibitor of growth protein 1 OS=Homo sapiens OX=9606 GN=ING1 PE=1 SV=2
7	AFDB:F4JUQ2	0.076	0.040	2.175E-1	920	0.163	0.072	F4JUQ2.pdb.gz	KCAI_ARATH KIN14B-interacting protein At4g14310 OS=Arabidopsis thaliana OX=3702 GN=At4g14310 PE=1 SV=1
8	AFDB:Q9U2Z0	0.077	0.079	2.175E-1	391	0.140	0.146	Q9U2Z0.pdb.gz	OTXH_CAEEL Homeobox protein ttx-1 OS=Caenorhabditis elegans OX=6239 GN=ttx-1 PE=1 SV=2
9	AFDB:O93507	0.092	0.111	2.490E-1	324	0.133	0.167	O93507.pdb.gz	TAL1_DANRE T-cell acute lymphocytic leukemia protein 1 homolog OS=Danio rerio OX=7955 GN=tal1 PE=1 SV=1
10	AFDB:Q95SP2	0.117	0.080	2.665E-1	626	0.113	0.073	Q95SP2.pdb.gz	HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster OX=7227 GN=sip3 PE=1 SV=1
11	PDB:7r5jV0	0.093	0.136	8.024	273	0.022	0.033	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:5n9jG	0.097	0.232	8.585	163	0.042	0.104	5n9jG.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TC90	0.0	820	406	1.000	1.000	CCER1_HUMAN Coiled-coil domain-containing glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=CCER1 PE=1 SV=1
2	Q8IDX6	3.59e-04	45.4	3130	0.067	0.009	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
3	Q6FIU8	3.79e-04	45.4	4880	0.067	0.006	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
4	O94248	4.65e-04	45.1	4717	0.101	0.009	MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mdn1 PE=1 SV=1
5	Q8II80	7.15e-04	44.3	1570	0.047	0.012	Q8II80_PLAF7 ATP-dependent 6-phosphofructokinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1128300 PE=4 SV=1
6	Q12019	0.002	43.5	4910	0.062	0.005	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
7	Q8IHN4	0.002	43.5	6093	0.074	0.005	Q8IHN4_PLAF7 Antigen 332, DBL-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1149000 PE=4 SV=2
8	C0H5F4	0.003	42.4	3254	0.059	0.007	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2
9	Q8I4Z1	0.005	41.6	1846	0.052	0.011	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
10	B9ZSJ2	0.029	39.3	1463	0.076	0.021	B9ZSJ2_PLAF7 Exported protein family 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0114000 PE=4 SV=1
11	Q54CF8	0.074	38.1	3071	0.054	0.007	Q54CF8_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293012 PE=4 SV=1
12	A0A0R4IJ71	0.18	36.6	4506	0.062	0.006	A0A0R4IJ71_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=2
13	E9QCV2	0.18	36.6	4530	0.062	0.006	E9QCV2_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=1
14	Q8I4T3	0.32	35.8	3119	0.059	0.008	Q8I4T3_PLAF7 Osmiophilic body protein G377 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1250100 PE=4 SV=1
15	F4K4D5	0.63	34.7	738	0.069	0.038	F4K4D5_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=TIF3B1 PE=1 SV=1
16	B9EJ86	0.65	34.7	889	0.084	0.038	OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus OX=10090 GN=Osbpl8 PE=1 SV=1
17	A0A0B4JD82	0.75	34.7	7905	0.064	0.003	A0A0B4JD82_DROME Stretchin-Mlck, isoform T OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
18	A0A0B4KF84	0.75	34.7	8216	0.064	0.003	A0A0B4KF84_DROME Stretchin-Mlck, isoform S OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
19	A0A0B4KG35	0.75	34.7	8255	0.064	0.003	A0A0B4KG35_DROME Stretchin-Mlck, isoform U OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
20	A1ZA72	0.75	34.7	7944	0.064	0.003	A1ZA72_DROME Stretchin-Mlck, isoform V OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15482 CCER1	6.8e-120	410.0	Coiled-coil domain-containing glutamate-rich protein family 1
2	PF15313 HEXIM	2.2	19.9	Hexamethylene bis-acetamide-inducible protein
3	PF06413 Neugrin	8.5e+02	11.2	Neugrin
4	PF04147 Nop14	1.8e+02	11.8	Nop14-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355840	0.761	Coiled-coil domain containing 185
2	9606.ENSP00000360320	0.757	Lymphocyte expansion molecule
3	9606.ENSP00000386414	0.624	Double-strand-break repair protein rad21-like protein 1
4	9606.ENSP00000313691	0.620	Ferritin, mitochondrial
5	9606.ENSP00000386118	0.571	Testis-expressed protein 33
6	9606.ENSP00000386791	0.563	Uncharacterized protein C21orf140
7	9606.ENSP00000420610	0.563	Uncharacterized protein C6orf201
8	9606.ENSP00000381631	0.562	Uncharacterized protein C2orf73
9	9606.ENSP00000479396	0.553	Uncharacterized protein C17orf98
10	9606.ENSP00000471272	0.552	Protein FAM71E1
11	9606.ENSP00000371054	0.521	Insulin-like peptide INSL6
12	9606.ENSP00000358965	0.520	Uncharacterized protein C1orf194
13	9606.ENSP00000340887	0.518	Uncharacterized protein C5orf47
14	9606.ENSP00000261172	0.503	Epiphycan

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.933	regulation of biological process
GO:0009987	0.929	cellular process
GO:0050794	0.777	regulation of cellular process
GO:0019222	0.763	regulation of metabolic process
GO:0060255	0.729	regulation of macromolecule metabolic process
GO:0010468	0.547	regulation of gene expression
GO:0048519	0.501	negative regulation of biological process
GO:0051171	0.469	regulation of nitrogen compound metabolic process
GO:0080090	0.467	regulation of primary metabolic process
GO:0031323	0.465	regulation of cellular metabolic process
GO:0048523	0.457	negative regulation of cellular process
GO:0009889	0.437	regulation of biosynthetic process
GO:0031326	0.412	regulation of cellular biosynthetic process
GO:0019219	0.411	regulation of nucleobase-containing compound metabolic process
GO:0032501	0.368	multicellular organismal process
GO:0010556	0.366	regulation of macromolecule biosynthetic process
GO:0006355	0.350	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0031981	0.987	nuclear lumen
GO:0005737	0.840	cytoplasm
GO:0032991	0.394	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]