StarFunc result for job id Q8TCD5

User Input

>input (201 residues)
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADK
VASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHL
GPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRL
LSWSDNWREILDSKRGAAQRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TCD5	1.000	1.000	1.071E-44	201	1.000	1.000	Q8TCD5.pdb.gz	NT5C_HUMAN 5'(3')-deoxyribonucleotidase, cytosolic type OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=2
2	PDB:2i7dA	0.946	0.985	1.017E-39	193	0.955	0.995	2i7dA.pdb.gz	Structures of Human and Murine cytosolic deoxyribonucleotidase: Insights into substrate specificity and catalysis
3	AFDB:Q9JM14	0.976	0.981	3.978E-39	200	0.831	0.835	Q9JM14.pdb.gz	NT5C_MOUSE 5'(3')-deoxyribonucleotidase, cytosolic type OS=Mus musculus OX=10090 GN=Nt5c PE=1 SV=1
4	PDB:2jaoA	0.959	0.984	5.420E-38	196	0.826	0.847	2jaoA.pdb.gz	Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
5	AFDB:Q9NPB1	0.959	0.846	2.649E-32	228	0.587	0.518	Q9NPB1.pdb.gz	NT5M_HUMAN 5'(3')-deoxyribonucleotidase, mitochondrial OS=Homo sapiens OX=9606 GN=NT5M PE=1 SV=1
6	AFDB:J3KRC4	0.798	0.880	3.211E-32	182	0.766	0.846	J3KRC4.pdb.gz	J3KRC4_HUMAN 5', 3'-nucleotidase, cytosolic OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=1
7	AFDB:Q8VCE6	0.961	0.879	3.892E-32	220	0.582	0.532	Q8VCE6.pdb.gz	NT5M_MOUSE 5'(3')-deoxyribonucleotidase, mitochondrial OS=Mus musculus OX=10090 GN=Nt5m PE=1 SV=1
8	AFDB:J3KSX6	0.511	0.671	3.140E-25	153	0.756	0.993	J3KSX6.pdb.gz	J3KSX6_HUMAN 5', 3'-nucleotidase, cytosolic (Fragment) OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=1
9	AFDB:O59760	0.583	0.511	2.396E-6	236	0.164	0.140	O59760.pdb.gz	YJM7_SCHPO Putative uncharacterized hydrolase C1020.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1020.07 PE=3 SV=1
10	AFDB:P31467	0.589	0.546	1.191E-5	221	0.204	0.186	P31467.pdb.gz	YIEH_ECOLI 6-phosphogluconate phosphatase OS=Escherichia coli (strain K12) OX=83333 GN=yieH PE=1 SV=1
11	AFDB:G5EG26	0.491	0.435	1.269E-5	233	0.169	0.146	G5EG26.pdb.gz	G5EG26_CAEEL R151.8A protein OS=Caenorhabditis elegans OX=6239 GN=R151.8A PE=1 SV=1
12	AFDB:O14165	0.570	0.477	1.865E-5	249	0.174	0.141	O14165.pdb.gz	YDX1_SCHPO Uncharacterized protein C4C5.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4C5.01 PE=3 SV=2
13	PDB:3l5kA	0.526	0.466	4.498E-5	233	0.164	0.142	3l5kA.pdb.gz
14	PDB:4uauA	0.514	0.470	1.035E-4	226	0.149	0.133	4uauA.pdb.gz	Degradation of potent Rubisco inhibitor by selective sugar phosphatase.
15	PDB:1rkuA	0.434	0.425	2.235E-4	206	0.184	0.180	1rkuA.pdb.gz	The thrH Gene Product of Pseudomonas aeruginosa Is a Dual Activity Enzyme with a Novel Phosphoserine:Homoserine Phosphotransferase Activity.
16	PDB:1te2A	0.513	0.481	2.709E-4	218	0.139	0.128	1te2A.pdb.gz	Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
17	PDB:2qltA	0.409	0.347	3.501E-4	251	0.139	0.112	2qltA.pdb.gz	The crystal structure of an isoform of DL-glycerol-3-phosphatase, Rhr2p from Saccharomyces cerevisiae.
18	PDB:2w4mA	0.514	0.431	3.501E-4	250	0.114	0.092	2w4mA.pdb.gz
19	PDB:2g80A	0.318	0.291	7.558E-4	225	0.119	0.107	2g80A.pdb.gz	Crystal structure of UTR4 protein (Unknown transcript 4 protein) (yel038w) from Saccharomyces cerevisiae at 2.28 A resolution
20	PDB:4g9bA	0.532	0.485	1.346E-3	227	0.164	0.145	4g9bA.pdb.gz	Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TCD5	2.24e-148	412	201	1.000	1.000	NT5C_HUMAN 5'(3')-deoxyribonucleotidase, cytosolic type OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=2
2	V9HWF3	2.24e-148	412	201	1.000	1.000	V9HWF3_HUMAN Epididymis luminal protein 74 OS=Homo sapiens OX=9606 GN=HEL74 PE=2 SV=1
3	Q9JM14	8.96e-127	357	200	0.831	0.835	NT5C_MOUSE 5'(3')-deoxyribonucleotidase, cytosolic type OS=Mus musculus OX=10090 GN=Nt5c PE=1 SV=1
4	J3KRC4	5.51e-107	306	182	0.751	0.830	J3KRC4_HUMAN 5', 3'-nucleotidase, cytosolic OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=1
5	J3KSX6	6.67e-104	297	153	0.761	1.000	J3KSX6_HUMAN 5', 3'-nucleotidase, cytosolic (Fragment) OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=1
6	Q9NPB1	3.21e-85	253	228	0.582	0.513	NT5M_HUMAN 5'(3')-deoxyribonucleotidase, mitochondrial OS=Homo sapiens OX=9606 GN=NT5M PE=1 SV=1
7	Q8VCE6	4.08e-85	252	220	0.587	0.536	NT5M_MOUSE 5'(3')-deoxyribonucleotidase, mitochondrial OS=Mus musculus OX=10090 GN=Nt5m PE=1 SV=1
8	Q98TU2	1.1	32.3	661	0.090	0.027	Q98TU2_DANRE Eomesa protein OS=Danio rerio OX=7955 GN=eomes PE=2 SV=1
9	Q5AYU5	2.8	30.8	216	0.104	0.097	Q5AYU5_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06535 PE=4 SV=1
10	Q9D113	3.8	30.0	177	0.100	0.113	DNLZ_MOUSE DNL-type zinc finger protein OS=Mus musculus OX=10090 GN=Dnlz PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06941 NT5C	1.9e-23	94.8	5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245552

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484415	0.984	Cytosolic 5'-nucleotidase 3A
2	9606.ENSP00000235628	0.958	Cytosolic 5'-nucleotidase 1A
3	9606.ENSP00000286648	0.954	Deoxycytidine kinase
4	9606.ENSP00000349576	0.951	Deoxycytidylate deaminase
5	9606.ENSP00000379038	0.948	Thymidine phosphorylase
6	9606.ENSP00000369456	0.943	Inosine triphosphate pyrophosphatase
7	9606.ENSP00000370376	0.941	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
8	9606.ENSP00000232607	0.939	Uridine 5'-monophosphate synthase
9	9606.ENSP00000339479	0.939	Cytosolic purine 5'-nucleotidase
10	9606.ENSP00000352904	0.937	Cytosolic 5'-nucleotidase 1B
11	9606.ENSP00000304802	0.935	Thymidylate kinase
12	9606.ENSP00000315644	0.930	Thymidylate synthase
13	9606.ENSP00000364212	0.930	Cytidine deaminase
14	9606.ENSP00000301634	0.926	Thymidine kinase, cytosolic
15	9606.ENSP00000389948	0.921	7-methylguanosine phosphate-specific 5'-nucleotidase
16	9606.ENSP00000367615	0.918	Adenine phosphoribosyltransferase
17	9606.ENSP00000354532	0.916	Purine nucleoside phosphorylase
18	9606.ENSP00000361965	0.916	Adenosine deaminase
19	9606.ENSP00000286621	0.913	Adenosine kinase
20	9606.ENSP00000355689	0.910	Guanylate kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008252	1.000	nucleotidase activity
GO:0005515	0.985	protein binding
GO:1901363	0.956	heterocyclic compound binding
GO:0097159	0.956	organic cyclic compound binding
GO:0036094	0.939	small molecule binding
GO:1901265	0.913	nucleoside phosphate binding
GO:0000166	0.903	nucleotide binding
GO:0042802	0.892	identical protein binding
GO:0008253	0.887	5'-nucleotidase activity
GO:0019103	0.775	pyrimidine nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0055086	0.985	nucleobase-containing small molecule metabolic process
GO:0006796	0.970	phosphate-containing compound metabolic process
GO:0019637	0.970	organophosphate metabolic process
GO:0006753	0.948	nucleoside phosphate metabolic process
GO:0009117	0.928	nucleotide metabolic process
GO:1901564	0.919	organonitrogen compound metabolic process
GO:1901135	0.907	carbohydrate derivative metabolic process
GO:1901565	0.769	organonitrogen compound catabolic process
GO:0006220	0.756	pyrimidine nucleotide metabolic process
GO:0009394	0.746	2'-deoxyribonucleotide metabolic process
GO:0034655	0.707	nucleobase-containing compound catabolic process
GO:1901292	0.673	nucleoside phosphate catabolic process
GO:0009219	0.662	pyrimidine deoxyribonucleotide metabolic process
GO:0072529	0.659	pyrimidine-containing compound catabolic process
GO:1901136	0.658	carbohydrate derivative catabolic process
GO:0009166	0.636	nucleotide catabolic process
GO:0016311	0.430	dephosphorylation
GO:0009123	0.354	nucleoside monophosphate metabolic process
GO:0072521	0.341	purine-containing compound metabolic process
GO:0006163	0.334	purine nucleotide metabolic process
GO:0019693	0.315	ribose phosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.964	organelle
GO:0043227	0.952	membrane-bounded organelle
GO:0043229	0.880	intracellular organelle
GO:0043231	0.807	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22140	1.000	a nucleoside 5'-phosphate + H2O = a nucleoside + phosphate
RHEA:12484	0.887	a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate
EC:3.1.3.5	0.887	5'-nucleotidase.

[back to server]