StarFunc result for job id Q8TCF1

User Input

>input (268 residues)
MAELDIGQHCQVEHCRQRDFLPFVCDDCSGIFCLEHRSRESHGCPEVTVINERLKTDQHT
SYPCSFKDCAERELVAVICPYCEKNFCLRHRHQSDHECEKLEIPKPRMAATQKLVKDIID
SKTGETASKRWKGAKNSETAAKVALMKLKMHADGDKSLPQTERIYFQVFLPKGSKEKSKP
MFFCHRWSIGKAIDFAASLARLKNDNNKFTAKKLRLCHITSGEALPLDHTLETWIAKEDC
PLYNGGNIILEYLNDEEQFCKNVESYLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TCF1	1.000	1.000	1.904E-61	268	1.000	1.000	Q8TCF1.pdb.gz	ZFAN1_HUMAN AN1-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=ZFAND1 PE=1 SV=1
2	AFDB:P53899	0.359	0.352	2.098E-13	274	0.228	0.223	P53899.pdb.gz	CUZ1_YEAST CDC48-associated ubiquitin-like/zinc finger protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CUZ1 PE=1 SV=1
3	AFDB:Q9XUW8	0.246	0.307	1.748E-11	202	0.187	0.248	Q9XUW8.pdb.gz	Q9XUW8_CAEEL AN1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aip-1 PE=1 SV=1
4	AFDB:Q9JII7	0.168	0.258	5.367E-11	171	0.157	0.246	Q9JII7.pdb.gz	ZFN2A_MOUSE AN1-type zinc finger protein 2A OS=Mus musculus OX=10090 GN=Zfand2a PE=2 SV=1
5	AFDB:Q8N6M9	0.175	0.305	7.466E-11	145	0.153	0.283	Q8N6M9.pdb.gz	ZFN2A_HUMAN AN1-type zinc finger protein 2A OS=Homo sapiens OX=9606 GN=ZFAND2A PE=1 SV=2
6	AFDB:Q8WV99	0.167	0.174	3.888E-10	257	0.194	0.202	Q8WV99.pdb.gz	ZFN2B_HUMAN AN1-type zinc finger protein 2B OS=Homo sapiens OX=9606 GN=ZFAND2B PE=1 SV=1
7	AFDB:Q9SCM4	0.166	0.175	2.636E-9	249	0.157	0.169	Q9SCM4.pdb.gz	SAP13_ARATH Zinc finger AN1 and C2H2 domain-containing stress-associated protein 13 OS=Arabidopsis thaliana OX=3702 GN=SAP13 PE=2 SV=1
8	AFDB:Q67YE6	0.297	0.390	1.054E-8	186	0.183	0.263	Q67YE6.pdb.gz	SAP12_ARATH Zinc finger AN1 domain-containing stress-associated protein 12 OS=Arabidopsis thaliana OX=3702 GN=SAP12 PE=2 SV=2
9	AFDB:Q8R023	0.251	0.258	5.998E-5	259	0.116	0.120	Q8R023.pdb.gz	PCGF1_MOUSE Polycomb group RING finger protein 1 OS=Mus musculus OX=10090 GN=Pcgf1 PE=2 SV=2
10	AFDB:Q7ZYZ7	0.242	0.248	1.017E-4	261	0.119	0.123	Q7ZYZ7.pdb.gz	PCGF1_DANRE Polycomb group RING finger protein 1 OS=Danio rerio OX=7955 GN=pcgf1 PE=3 SV=1
11	PDB:7bruA	0.274	0.475	5.312E-4	138	0.063	0.123	7bruA.pdb.gz
12	PDB:7yo8A	0.282	0.492	1.098E-3	140	0.060	0.114	7yo8A.pdb.gz
13	PDB:7lswC	0.283	0.471	1.338E-3	145	0.052	0.097	7lswC.pdb.gz
14	PDB:5yipA	0.286	0.542	1.632E-3	123	0.049	0.106	5yipA.pdb.gz	Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.
15	PDB:7aa8C	0.289	0.519	1.743E-3	133	0.049	0.098	7aa8C.pdb.gz
16	PDB:6aafA	0.279	0.576	1.862E-3	112	0.056	0.134	6aafA.pdb.gz	Lipidation-independent vacuolar functions of Atg8 rely on its noncanonical interaction with a vacuole membrane protein
17	PDB:7np7D4	0.258	0.172	2.590E-3	415	0.052	0.034	7np7D4.pdb.gz
18	PDB:5azfA	0.290	0.568	3.157E-3	119	0.056	0.126	5azfA.pdb.gz	Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy.
19	PDB:6yvaC	0.234	0.381	3.157E-3	155	0.049	0.084	6yvaC.pdb.gz
20	PDB:4pyuA	0.231	0.720	4.111E-3	76	0.049	0.171	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TCF1	0.0	560	268	1.000	1.000	ZFAN1_HUMAN AN1-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=ZFAND1 PE=1 SV=1
2	Q9XUW8	3.75e-15	74.3	202	0.164	0.218	Q9XUW8_CAEEL AN1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aip-1 PE=1 SV=1
3	Q67YE6	2.71e-14	71.6	186	0.168	0.242	SAP12_ARATH Zinc finger AN1 domain-containing stress-associated protein 12 OS=Arabidopsis thaliana OX=3702 GN=SAP12 PE=2 SV=2
4	P53899	1.84e-13	70.9	274	0.231	0.226	CUZ1_YEAST CDC48-associated ubiquitin-like/zinc finger protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CUZ1 PE=1 SV=1
5	Q91X58	1.94e-13	70.5	257	0.168	0.175	ZFN2B_MOUSE AN1-type zinc finger protein 2B OS=Mus musculus OX=10090 GN=Zfand2b PE=1 SV=1
6	Q8WV99	1.02e-12	68.6	257	0.142	0.148	ZFN2B_HUMAN AN1-type zinc finger protein 2B OS=Homo sapiens OX=9606 GN=ZFAND2B PE=1 SV=1
7	Q9SCM4	5.90e-12	66.2	249	0.160	0.173	SAP13_ARATH Zinc finger AN1 and C2H2 domain-containing stress-associated protein 13 OS=Arabidopsis thaliana OX=3702 GN=SAP13 PE=2 SV=1
8	Q8N6M9	8.71e-12	63.5	145	0.146	0.269	ZFN2A_HUMAN AN1-type zinc finger protein 2A OS=Homo sapiens OX=9606 GN=ZFAND2A PE=1 SV=2
9	Q9JII7	1.04e-11	63.9	171	0.142	0.222	ZFN2A_MOUSE AN1-type zinc finger protein 2A OS=Mus musculus OX=10090 GN=Zfand2a PE=2 SV=1
10	Q387I5	0.051	37.4	517	0.116	0.060	Q387I5_TRYB2 C2H2-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0435 PE=4 SV=1
11	Q581T1	1.4	33.1	2167	0.082	0.010	REH2_TRYB2 RNA editing associated helicase 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=REH2 PE=1 SV=1
12	A0A1P8ASY1	1.6	32.7	1331	0.075	0.015	JHS1_ARATH DNA replication ATP-dependent helicase/nuclease JHS1 OS=Arabidopsis thaliana OX=3702 GN=JHS1 PE=2 SV=1
13	Q8MSE1	5.3	28.9	85	0.052	0.165	Q8MSE1_DROME GM31840p OS=Drosophila melanogaster OX=7227 GN=Ste PE=2 SV=1
14	Q96EP0	6.2	30.8	1072	0.049	0.012	RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens OX=9606 GN=RNF31 PE=1 SV=1
15	Q924T7	6.7	30.8	1066	0.049	0.012	RNF31_MOUSE E3 ubiquitin-protein ligase RNF31 OS=Mus musculus OX=10090 GN=Rnf31 PE=1 SV=2
16	Q08422	7.0	29.6	150	0.049	0.087	TMC1_YEAST AN1-type zinc finger protein TMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TMC1 PE=1 SV=1
17	Q810J8	7.2	30.4	777	0.164	0.057	ZFYV1_MOUSE Zinc finger FYVE domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zfyve1 PE=1 SV=2
18	P49966	7.6	30.4	497	0.075	0.040	SR542_ARATH Signal recognition particle subunit SRP54 2 OS=Arabidopsis thaliana OX=3702 GN=SRP-54B PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03406 Phage_fiber_2	2e+02	13.0	Phage tail fibre repeat
2	PF01428 zf-AN1	3.4e-21	86.4	AN1-like Zinc finger
3	PF02928 zf-C5HC2	59	15.4	C5HC2 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220669

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351777	0.803	Transitional endoplasmic reticulum ATPase
2	9606.ENSP00000261749	0.731	AN1-type zinc finger protein 6
3	9606.ENSP00000339484	0.690	Zinc finger AN1-type containing 4
4	9606.ENSP00000368305	0.610	Glycerophosphocholine phosphodiesterase GPCPD1
5	9606.ENSP00000262370	0.584	E3 ubiquitin-protein ligase MGRN1
6	9606.ENSP00000471242	0.576	FERM, ARHGEF and pleckstrin domain-containing protein 1
7	9606.ENSP00000281146	0.574	UPF0462 protein C4orf33
8	9606.ENSP00000354590	0.556	Vesicle transport protein SFT2A
9	9606.ENSP00000478478	0.556	Golgin subfamily A member 6-like protein 1
10	9606.ENSP00000379034	0.524	Kelch domain containing 7B
11	9606.ENSP00000331487	0.519	Nuclear protein localization protein 4 homolog
12	9606.ENSP00000362061	0.511	Oxidative stress-responsive serine-rich protein 1
13	9606.ENSP00000309474	0.504	26S proteasome non-ATPase regulatory subunit 1
14	9606.ENSP00000401115	0.504	SS18-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0070628	1.000	proteasome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032880	0.994	regulation of protein localization
GO:0022411	0.993	cellular component disassembly
GO:0032386	0.992	regulation of intracellular transport
GO:0043933	0.991	protein-containing complex organization
GO:0006996	0.988	organelle organization
GO:0048518	0.987	positive regulation of biological process
GO:0050896	0.976	response to stimulus
GO:0051050	0.975	positive regulation of transport
GO:0070201	0.975	regulation of establishment of protein localization
GO:1903829	0.975	positive regulation of protein localization
GO:0032984	0.973	protein-containing complex disassembly
GO:1903008	0.970	organelle disassembly
GO:0042221	0.968	response to chemical
GO:0090316	0.968	positive regulation of intracellular protein transport
GO:0046685	0.957	response to arsenic-containing substance
GO:0051716	0.830	cellular response to stimulus
GO:0071826	0.667	ribonucleoprotein complex subunit organization
GO:0010035	0.566	response to inorganic substance
GO:1901701	0.530	cellular response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0010494	0.988	cytoplasmic stress granule
GO:0070013	0.972	intracellular organelle lumen
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:0005634	0.950	nucleus
GO:0005654	0.944	nucleoplasm
GO:0005576	0.675	extracellular region
GO:0005829	0.637	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]