StarFunc result for job id Q8TCG5

User Input

>input (803 residues)
MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPILSDEDFDWTAVLAQEFLRLQASLLQWYLRLKSWWASNYVSDWWEEFV
YLRSRNPLMVNSNYYMMDFLYVTPTPLQAARAGNAVHALLLYRHRLNRQEIPPTLLMGMR
PLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRNSLLSPRALEQ
QFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGAAFFVSLDAE
PAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSTDGHCKGHPDPTLPQPQRLQWDLPDQIHSSISLALRGAKILSEN
VDCHVVPFSLFGKSFIRRCHLSSDSFIQIALQLAHFRDRGQFCLTYESAMTRLFLEGRTE
TVRSCTREACNFVRAMEDKEKTDPQCLALFRVAVDKHQALLKAAMSGQGVDRHLFALYIV
SRFLHLQSPFLTQVHSEQWQLSTSQIPVQQMHLFDVHNYPDYVSSGGGFGPADDHGYGVS
YIFMGDGMITFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKRRFRGSGKENS
RHRCGFLSRQTGASKASMTSTDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LN46	0.911	0.914	0.000	801	0.819	0.821	F1LN46.pdb.gz	CPT1C_RAT Carnitine O-palmitoyltransferase 1, brain isoform OS=Rattus norvegicus OX=10116 GN=Cpt1c PE=1 SV=1
2	AFDB:Q8TCG5	1.000	1.000	0.000	803	1.000	1.000	Q8TCG5.pdb.gz	CPT1C_HUMAN Carnitine O-palmitoyltransferase 1, brain isoform OS=Homo sapiens OX=9606 GN=CPT1C PE=1 SV=1
3	AFDB:P32198	0.920	0.955	2.900E-102	773	0.527	0.547	P32198.pdb.gz	CPT1A_RAT Carnitine O-palmitoyltransferase 1, liver isoform OS=Rattus norvegicus OX=10116 GN=Cpt1a PE=1 SV=2
4	AFDB:A0A024R5F4	0.923	0.958	1.407E-100	773	0.526	0.546	A0A024R5F4.pdb.gz
5	AFDB:F6P7Z9	0.920	0.959	2.369E-99	770	0.524	0.547	F6P7Z9.pdb.gz	F6P7Z9_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1al PE=3 SV=2
6	AFDB:E9QI17	0.922	0.955	1.093E-97	775	0.507	0.525	E9QI17.pdb.gz	E9QI17_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1ab PE=1 SV=2
7	AFDB:Q92523	0.923	0.959	1.664E-96	772	0.507	0.527	Q92523.pdb.gz	CPT1B_HUMAN Carnitine O-palmitoyltransferase 1, muscle isoform OS=Homo sapiens OX=9606 GN=CPT1B PE=1 SV=2
8	AFDB:Q2UZM8	0.922	0.957	2.491E-96	773	0.516	0.536	Q2UZM8.pdb.gz	Q2UZM8_ONCMY carnitine O-palmitoyltransferase OS=Oncorhynchus mykiss OX=8022 GN=cpt1 PE=2 SV=1
9	AFDB:Q63704	0.924	0.960	4.337E-96	772	0.499	0.519	Q63704.pdb.gz	CPT1B_RAT Carnitine O-palmitoyltransferase 1, muscle isoform OS=Rattus norvegicus OX=10116 GN=Cpt1b PE=1 SV=1
10	AFDB:A0A1L1U0X8	0.917	0.950	1.609E-95	774	0.493	0.512	A0A1L1U0X8.pdb.gz
11	PDB:2h3pA	0.669	0.890	1.201E-48	599	0.219	0.294	2h3pA.pdb.gz	Crystal structures of murine carnitine acetyltransferase in ternary complexes with its substrates
12	PDB:1xl8B	0.677	0.899	5.268E-47	600	0.220	0.295	1xl8B.pdb.gz	Crystal structure of mouse carnitine octanoyltransferase and molecular determinants of substrate selectivity.
13	PDB:1q6xA	0.665	0.881	5.728E-45	600	0.214	0.287	1q6xA.pdb.gz
14	PDB:4eywB	0.675	0.849	2.390E-43	634	0.207	0.262	4eywB.pdb.gz	Isothermal titration calorimetry with micelles: Thermodynamics of inhibitor binding to carnitine palmitoyltransferase 2 membrane protein.
15	PDB:6lpwB	0.195	0.318	3.679E-5	436	0.047	0.087	6lpwB.pdb.gz	Structural and Biochemical Insights Into Two BAHD Acyltransferases ( At SHT and At SDT) Involved in Phenolamide Biosynthesis.
16	PDB:1l5aA	0.264	0.426	5.791E-5	424	0.076	0.144	1l5aA.pdb.gz
17	PDB:7cysA	0.192	0.316	4.813E-4	431	0.052	0.097	7cysA.pdb.gz
18	PDB:2xr7A	0.204	0.323	5.889E-4	452	0.051	0.091	2xr7A.pdb.gz	Structural Basis for Modification of Flavonol and Naphthol Glucoconjugates by Nicotiana Tabacum Malonyltransferase (Ntmat1).
19	PDB:5kjtA	0.188	0.314	6.193E-4	431	0.064	0.118	5kjtA.pdb.gz	Dynamic Conformational States Dictate Selectivity toward the Native Substrate in a Substrate-Permissive Acyltransferase.
20	PDB:6mk2A	0.187	0.320	1.134E-3	407	0.050	0.098	6mk2A.pdb.gz	Independent evolution of rosmarinic acid biosynthesis in two sister families under the Lamiids clade of flowering plants.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRE8	0.0	658	567	0.392	0.556	A2RRE8_HUMAN CPT1B protein OS=Homo sapiens OX=9606 GN=CPT1B PE=1 SV=1
2	E9QI17	0.0	872	775	0.509	0.528	E9QI17_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1ab PE=1 SV=2
3	F1LN46	0.0	1347	801	0.822	0.824	CPT1C_RAT Carnitine O-palmitoyltransferase 1, brain isoform OS=Rattus norvegicus OX=10116 GN=Cpt1c PE=1 SV=1
4	F6P7Z9	0.0	865	770	0.523	0.545	F6P7Z9_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1al PE=3 SV=2
5	K7DY29	0.0	879	774	0.506	0.525	K7DY29_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1ab PE=1 SV=1
6	P32198	0.0	909	773	0.529	0.550	CPT1A_RAT Carnitine O-palmitoyltransferase 1, liver isoform OS=Rattus norvegicus OX=10116 GN=Cpt1a PE=1 SV=2
7	P50416	0.0	919	773	0.527	0.547	CPT1A_HUMAN Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens OX=9606 GN=CPT1A PE=1 SV=2
8	P97742	0.0	913	773	0.528	0.549	CPT1A_MOUSE Carnitine O-palmitoyltransferase 1, liver isoform OS=Mus musculus OX=10090 GN=Cpt1a PE=1 SV=4
9	Q1MTA9	0.0	834	773	0.494	0.514	Q1MTA9_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1a PE=1 SV=2
10	Q2UZM8	0.0	853	773	0.516	0.536	Q2UZM8_ONCMY carnitine O-palmitoyltransferase OS=Oncorhynchus mykiss OX=8022 GN=cpt1 PE=2 SV=1
11	Q63704	0.0	827	772	0.501	0.521	CPT1B_RAT Carnitine O-palmitoyltransferase 1, muscle isoform OS=Rattus norvegicus OX=10116 GN=Cpt1b PE=1 SV=1
12	Q7JQH9	0.0	663	780	0.428	0.441	Q7JQH9_DROME carnitine O-palmitoyltransferase OS=Drosophila melanogaster OX=7227 GN=whd PE=1 SV=1
13	Q8AYL4	0.0	826	750	0.508	0.544	Q8AYL4_ONCMY carnitine O-palmitoyltransferase OS=Oncorhynchus mykiss OX=8022 GN=CPT1 PE=2 SV=2
14	Q8BGD5	0.0	1364	798	0.833	0.838	CPT1C_MOUSE Carnitine O-palmitoyltransferase 1, brain isoform OS=Mus musculus OX=10090 GN=Cpt1c PE=1 SV=1
15	Q8TCG5	0.0	1656	803	1.000	1.000	CPT1C_HUMAN Carnitine O-palmitoyltransferase 1, brain isoform OS=Homo sapiens OX=9606 GN=CPT1C PE=1 SV=1
16	Q924X2	0.0	834	772	0.508	0.528	CPT1B_MOUSE Carnitine O-palmitoyltransferase 1, muscle isoform OS=Mus musculus OX=10090 GN=Cpt1b PE=1 SV=1
17	Q92523	0.0	845	772	0.509	0.530	CPT1B_HUMAN Carnitine O-palmitoyltransferase 1, muscle isoform OS=Homo sapiens OX=9606 GN=CPT1B PE=1 SV=2
18	Q9V3K9	0.0	660	782	0.427	0.439	Q9V3K9_DROME carnitine O-palmitoyltransferase OS=Drosophila melanogaster OX=7227 GN=whd PE=1 SV=1
19	Q704S8	9.13e-82	276	626	0.239	0.307	CACP_RAT Carnitine O-acetyltransferase OS=Rattus norvegicus OX=10116 GN=Crat PE=1 SV=1
20	P43155	5.77e-81	274	626	0.242	0.310	CACP_HUMAN Carnitine O-acetyltransferase OS=Homo sapiens OX=9606 GN=CRAT PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00755 Carn_acyltransf	5.1e-174	591.7	Choline/Carnitine o-acyltransferase
2	PF16484 CPT_N	8.7e-20	81.7	Carnitine O-palmitoyltransferase N-terminus
3	PF09298 FAA_hydrolase_N	1.5e+02	13.9	Fumarylacetoacetase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376303

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326305	0.989	Mitochondrial carnitine/acylcarnitine carrier protein
2	9606.ENSP00000360541	0.936	Carnitine O-palmitoyltransferase 2, mitochondrial
3	9606.ENSP00000341044	0.903	Acetyl-CoA carboxylase 2
4	9606.ENSP00000384400	0.839	Choline/ethanolamine kinase
5	9606.ENSP00000428994	0.838	Glutamate receptor 1
6	9606.ENSP00000422607	0.826	Long-chain-fatty-acid--CoA ligase 1
7	9606.ENSP00000265641	0.810	Carnitine O-palmitoyltransferase 1, liver isoform
8	9606.ENSP00000379011	0.809	Carnitine O-palmitoyltransferase 1, muscle isoform
9	9606.ENSP00000350012	0.776	Long-chain-fatty-acid--CoA ligase 3
10	9606.ENSP00000348429	0.768	Long-chain-fatty-acid--CoA ligase 5
11	9606.ENSP00000477141	0.760	DOMON domain-containing protein FRRS1L
12	9606.ENSP00000339787	0.744	Long-chain-fatty-acid--CoA ligase 4
13	9606.ENSP00000366915	0.740	Krueppel-like factor 5
14	9606.ENSP00000351155	0.722	Atlastin-1
15	9606.ENSP00000368566	0.707	Long-chain-fatty-acid--CoA ligase 6
16	9606.ENSP00000373713	0.698	Phosphatidylinositide phosphatase SAC1
17	9606.ENSP00000258873	0.695	Long-chain-fatty-acid--CoA ligase ACSBG1
18	9606.ENSP00000465589	0.694	Long-chain-fatty-acid--CoA ligase ACSBG2
19	9606.ENSP00000385523	0.688	Peroxisome proliferator-activated receptor alpha
20	9606.ENSP00000005178	0.679	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016406	1.000	carnitine O-acyltransferase activity
GO:0005515	0.998	protein binding
GO:0016409	0.997	palmitoyltransferase activity
GO:0004095	0.952	carnitine O-palmitoyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.978	organic substance metabolic process
GO:0044237	0.977	cellular metabolic process
GO:0065007	0.804	biological regulation
GO:0006807	0.775	nitrogen compound metabolic process
GO:1901564	0.709	organonitrogen compound metabolic process
GO:0044238	0.689	primary metabolic process
GO:0006575	0.544	cellular modified amino acid metabolic process
GO:0034641	0.490	cellular nitrogen compound metabolic process
GO:0050789	0.390	regulation of biological process
GO:0050794	0.354	regulation of cellular process
GO:0006577	0.351	amino-acid betaine metabolic process
GO:0044281	0.306	small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0031090	0.994	organelle membrane
GO:0005739	0.986	mitochondrion
GO:0031984	0.962	organelle subcompartment
GO:0098827	0.916	endoplasmic reticulum subcompartment
GO:0042175	0.914	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.891	endoplasmic reticulum membrane
GO:0031967	0.352	organelle envelope
GO:0098588	0.315	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:12661	0.952	(R)-carnitine + hexadecanoyl-CoA = CoA + O-hexadecanoyl-(R)-carnitine
EC:2.3.1.21	0.952	carnitine O-palmitoyltransferase.

[back to server]