StarFunc result for job id Q8TCI5

User Input

>input (191 residues)
MCFSRADAADNYPFGTCQQRKLFPHFHPPNLIGNKFVPLRGSPHRGPGCYFSDGYGLAYD
LSKIPTSIKGYTLGARTAVRFKPIQKEMTPHAGRYQKVSPQQEKHKQNFAPFNVLVPRFK
NYPKDTYYPSPGAYNPEKKPPPKIAWPMKFGSPDWAQVPCLQKRTLKAELSTDKDFRKHR
NRVAYLSLYYN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TCI5	1.000	1.000	2.035E-34	191	1.000	1.000	Q8TCI5.pdb.gz	CMAP3_HUMAN Ciliary microtubule-associated protein 3 OS=Homo sapiens OX=9606 GN=CIMAP3 PE=1 SV=2
2	AFDB:Q9D9W1	0.342	0.319	4.854E-20	207	0.660	0.609	Q9D9W1.pdb.gz	CMAP3_MOUSE Ciliary microtubule-associated protein 3 OS=Mus musculus OX=10090 GN=Cimap3 PE=1 SV=1
3	AFDB:Q38DR1	0.145	0.076	2.948	476	0.204	0.082	Q38DR1.pdb.gz	Q38DR1_TRYB2 Sperm-tail PG-rich repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2450 PE=4 SV=1
4	AFDB:Q8SXU1	0.100	0.067	4.386	382	0.173	0.086	Q8SXU1.pdb.gz	Q8SXU1_DROME RE21313p OS=Drosophila melanogaster OX=7227 GN=CG5199 PE=2 SV=1
5	AFDB:Q8IW93	0.105	0.044	6.526	802	0.194	0.046	Q8IW93.pdb.gz	ARHGJ_HUMAN Rho guanine nucleotide exchange factor 19 OS=Homo sapiens OX=9606 GN=ARHGEF19 PE=1 SV=1
6	AFDB:O13067	0.100	0.038	6.973	699	0.126	0.034	O13067.pdb.gz	CND2_XENLA Condensin complex subunit 2 OS=Xenopus laevis OX=8355 GN=ncaph PE=1 SV=1
7	AFDB:A0A1D8PKB6	0.097	0.040	7.450	740	0.178	0.046	A0A1D8PKB6.pdb.gz	A0A1D8PKB6_CANAL Beta-glucan synthesis-associated protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KRE6 PE=3 SV=1
8	PDB:7aavv	0.082	0.077	9.136	206	0.105	0.097	7aavv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
9	PDB:7mqaNA	0.131	0.096	9.761	295	0.115	0.075	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TCI5	1.08e-142	396	191	1.000	1.000	CMAP3_HUMAN Ciliary microtubule-associated protein 3 OS=Homo sapiens OX=9606 GN=CIMAP3 PE=1 SV=2
2	Q9D9W1	1.66e-91	268	207	0.660	0.609	CMAP3_MOUSE Ciliary microtubule-associated protein 3 OS=Mus musculus OX=10090 GN=Cimap3 PE=1 SV=1
3	P50280	0.47	33.1	267	0.115	0.082	MMP7_RAT Matrilysin OS=Rattus norvegicus OX=10116 GN=Mmp7 PE=2 SV=1
4	Q38DR1	1.2	32.0	476	0.115	0.046	Q38DR1_TRYB2 Sperm-tail PG-rich repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2450 PE=4 SV=1
5	Q5BFS3	3.6	30.8	4761	0.079	0.003	Q5BFS3_EMENI Ferricrocin synthetase (Nonribosomal peptide siderophore synthase ) (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00607 PE=4 SV=1
6	B3DI43	5.1	30.0	252	0.120	0.091	B3DI43_DANRE Outer dense fiber of sperm tails 3-like 2b OS=Danio rerio OX=7955 GN=cimap1d PE=2 SV=1
7	O77469	7.0	29.6	728	0.089	0.023	FBLN1_CAEEL Fibulin-1 OS=Caenorhabditis elegans OX=6239 GN=fbl-1 PE=1 SV=3
8	A0A0R4IUF0	8.4	29.6	1570	0.089	0.011	A0A0R4IUF0_DANRE DNA topoisomerase 2 OS=Danio rerio OX=7955 GN=fc08c07 PE=1 SV=2
9	P16573	8.6	29.6	519	0.063	0.023	CEAM1_RAT Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=4
10	Q0E9I4	9.9	29.3	2031	0.157	0.015	Q0E9I4_DROME Down syndrome cell adhesion molecule 1, isoform O OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07004 SHIPPO-rpt	1.1e+02	15.1	Sperm-tail PG-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358753

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000437872	0.838	G-protein coupled receptor-associated sorting protein 2
2	9606.ENSP00000350266	0.785	DENN domain-containing protein 2D
3	9606.ENSP00000437082	0.677	Chitinase-3-like protein 2
4	9606.ENSP00000368464	0.626	Kinesin-like protein KIF24
5	9606.ENSP00000368759	0.615	Enhancer of filamentation 1
6	9606.ENSP00000370803	0.567	Centriolar coiled-coil protein of 110 kDa
7	9606.ENSP00000278935	0.566	Centrosomal protein of 164 kDa
8	9606.ENSP00000373583	0.566	Protein STPG3
9	9606.ENSP00000379643	0.564	Nuclear distribution protein nudE homolog 1
10	9606.ENSP00000306105	0.561	Centrosomal protein of 89 kDa
11	9606.ENSP00000356056	0.550	Dynein light chain Tctex-type 1
12	9606.ENSP00000380911	0.543	Centrosomal protein of 83 kDa
13	9606.ENSP00000281142	0.540	Sodium channel and clathrin linker 1
14	9606.ENSP00000362109	0.540	Fibroblast growth factor receptor substrate 3
15	9606.ENSP00000286732	0.526	Cilia- and flagella-associated protein 161
16	9606.ENSP00000342510	0.523	Centrosomal protein of 97 kDa
17	9606.ENSP00000324292	0.521	Fas-binding factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019894	1.000	kinesin binding
GO:0048487	1.000	beta-tubulin binding
GO:0043015	1.000	gamma-tubulin binding
GO:0031267	1.000	small GTPase binding
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.973	regulation of metabolic process
GO:0050790	0.929	regulation of catalytic activity
GO:0031323	0.919	regulation of cellular metabolic process
GO:0051174	0.877	regulation of phosphorus metabolic process
GO:0009987	0.873	cellular process
GO:0051338	0.862	regulation of transferase activity
GO:0048518	0.852	positive regulation of biological process
GO:0044093	0.824	positive regulation of molecular function
GO:0009893	0.788	positive regulation of metabolic process
GO:0031325	0.775	positive regulation of cellular metabolic process
GO:0019220	0.704	regulation of phosphate metabolic process
GO:0043085	0.692	positive regulation of catalytic activity
GO:0051347	0.672	positive regulation of transferase activity
GO:0010562	0.669	positive regulation of phosphorus metabolic process
GO:0042325	0.626	regulation of phosphorylation
GO:0071840	0.610	cellular component organization or biogenesis
GO:0045937	0.587	positive regulation of phosphate metabolic process
GO:0016043	0.578	cellular component organization
GO:0043549	0.577	regulation of kinase activity
GO:0006996	0.554	organelle organization
GO:0042327	0.478	positive regulation of phosphorylation
GO:0033674	0.346	positive regulation of kinase activity
GO:0044782	0.302	cilium organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005929	1.000	cilium
GO:0005634	0.999	nucleus
GO:0005815	0.998	microtubule organizing center
GO:0012505	0.997	endomembrane system
GO:0005794	0.991	Golgi apparatus
GO:0036064	0.990	ciliary basal body
GO:0031984	0.985	organelle subcompartment
GO:0098791	0.975	Golgi apparatus subcompartment
GO:0005802	0.972	trans-Golgi network
GO:0005829	0.503	cytosol
GO:0043073	0.355	germ cell nucleus
GO:0099080	0.354	supramolecular complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]