StarFunc result for job id Q8TCJ2

User Input

>input (826 residues)
MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSG
GLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFY
EFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGL
TSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKS
VKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIV
GLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLA
AGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHI
LVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVF
EHYLGDDMKRENPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGPNIKSIVT
MLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHAR
VMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRTLDVDYVLVI
FGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKM
SYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRET
LDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKISKKTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E2RG47	0.886	0.886	5.428E-104	826	0.993	0.993	E2RG47.pdb.gz	STT3B_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
2	PDB:6s7tA	0.813	0.949	4.681E-86	706	0.855	1.000	6s7tA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
3	AFDB:Q7KN63	0.833	0.862	1.398E-85	797	0.665	0.689	Q7KN63.pdb.gz	Q7KN63_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Stt3B PE=2 SV=1
4	AFDB:Q9VRE0	0.822	0.951	1.570E-73	713	0.508	0.589	Q9VRE0.pdb.gz	Q9VRE0_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Drosophila melanogaster OX=7227 GN=Stt3A PE=1 SV=1
5	AFDB:F1PJP5	0.821	0.961	2.277E-73	705	0.511	0.599	F1PJP5.pdb.gz	STT3A_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Canis lupus familiaris OX=9615 GN=STT3A PE=1 SV=3
6	AFDB:Q9FX21	0.823	0.923	5.038E-72	735	0.484	0.544	Q9FX21.pdb.gz	STT3B_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Arabidopsis thaliana OX=3702 GN=STT3B PE=2 SV=1
7	AFDB:Q5ALU8	0.816	0.896	3.366E-71	751	0.500	0.550	Q5ALU8.pdb.gz	Q5ALU8_CANAL dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STT3 PE=3 SV=1
8	AFDB:O94335	0.799	0.875	1.987E-70	752	0.481	0.528	O94335.pdb.gz	STT3_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
9	AFDB:P39007	0.790	0.908	1.056E-67	718	0.460	0.529	P39007.pdb.gz	STT3_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
10	AFDB:Q93ZY3	0.796	0.843	2.901E-65	779	0.444	0.471	Q93ZY3.pdb.gz	STT3A_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Arabidopsis thaliana OX=3702 GN=STT3A PE=2 SV=1
11	PDB:6s7oA	0.773	0.972	3.450E-62	656	0.498	0.627	6s7oA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
12	PDB:6eznF	0.717	0.906	5.072E-52	650	0.416	0.529	6eznF.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
13	AFDB:Q57W35	0.736	0.741	3.376E-45	821	0.288	0.290	Q57W35.pdb.gz	Q57W35_TRYB2 dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.500 PE=3 SV=1
14	PDB:5oglA	0.514	0.591	3.105E-13	707	0.117	0.137	5oglA.pdb.gz	Molecular basis of lipid-linked oligosaccharide recognition and processing by bacterial oligosaccharyltransferase.
15	PDB:3rceA	0.511	0.608	3.663E-13	683	0.122	0.148	3rceA.pdb.gz	X-ray structure of a bacterial oligosaccharyltransferase.
16	PDB:3waiA	0.088	0.100	1.230E-2	711	0.047	0.055	3waiA.pdb.gz
17	PDB:6p25B	0.229	0.270	2.019E-2	690	0.036	0.043	6p25B.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
18	PDB:6p25A	0.208	0.232	3.179E-2	731	0.042	0.048	6p25A.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
19	PDB:4gbyA	0.077	0.108	1.406E-1	475	0.065	0.114	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
20	PDB:7bvfB	0.244	0.198	1.801E-1	1054	0.073	0.057	7bvfB.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E2RG47	0.0	1712	826	0.994	0.994	STT3B_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
2	F1PJP5	0.0	866	705	0.518	0.607	STT3A_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Canis lupus familiaris OX=9615 GN=STT3A PE=1 SV=3
3	O94335	0.0	815	752	0.483	0.531	STT3_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
4	P39007	0.0	747	718	0.470	0.540	STT3_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
5	P46977	0.0	865	705	0.518	0.607	STT3A_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A PE=1 SV=2
6	P46978	0.0	868	705	0.518	0.607	STT3A_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Mus musculus OX=10090 GN=Stt3a PE=1 SV=1
7	Q5ALU8	0.0	827	751	0.504	0.554	Q5ALU8_CANAL dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STT3 PE=3 SV=1
8	Q7KN63	0.0	1140	797	0.669	0.694	Q7KN63_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Stt3B PE=2 SV=1
9	Q8TCJ2	0.0	1722	826	1.000	1.000	STT3B_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
10	Q93ZY3	0.0	707	779	0.439	0.466	STT3A_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Arabidopsis thaliana OX=3702 GN=STT3A PE=2 SV=1
11	Q9FX21	0.0	804	735	0.481	0.540	STT3B_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Arabidopsis thaliana OX=3702 GN=STT3B PE=2 SV=1
12	Q9VRE0	0.0	883	713	0.518	0.600	Q9VRE0_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Drosophila melanogaster OX=7227 GN=Stt3A PE=1 SV=1
13	Q9XZ53	0.0	1142	774	0.669	0.714	Q9XZ53_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Drosophila melanogaster OX=7227 GN=Stt3B PE=1 SV=1
14	Q57W35	8.88e-110	357	821	0.300	0.302	Q57W35_TRYB2 dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.500 PE=3 SV=1
15	Q57W36	3.17e-107	350	821	0.294	0.296	Q57W36_TRYB2 dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.490 PE=3 SV=1
16	Q57W34	4.66e-103	338	801	0.286	0.295	Q57W34_TRYB2 dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.510 PE=3 SV=1
17	Q2EMT4	2.85e-04	47.0	917	0.057	0.051	AGLB_METVO Dolichyl-phosphooligosaccharide-protein glycotransferase OS=Methanococcus voltae OX=2188 GN=aglB PE=1 SV=1
18	D4GYH4	0.23	37.7	1054	0.057	0.045	AGLB_HALVD Dolichyl-monophosphooligosaccharide--protein glycotransferase AglB OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglB PE=1 SV=1
19	Q5HTX9	1.0	35.4	713	0.025	0.029	PGLB_CAMJR Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=pglB PE=1 SV=1
20	B9KDD4	1.6	34.7	712	0.035	0.041	PGLB_CAMLR Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) OX=306263 GN=pglB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02516 STT3	1.1e-146	501.3	Oligosaccharyl transferase STT3 subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000237530	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
2	9606.ENSP00000296255	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
3	9606.ENSP00000354649	0.999	Magnesium transporter protein 1
4	9606.ENSP00000399457	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
5	9606.ENSP00000250498	0.998	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
6	9606.ENSP00000424544	0.995	Tumor suppressor candidate 3
7	9606.ENSP00000443216	0.985	Transmembrane protein 258
8	9606.ENSP00000457935	0.985	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4
9	9606.ENSP00000266483	0.973	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
10	9606.ENSP00000233616	0.958	Mannosyl-oligosaccharide glucosidase
11	9606.ENSP00000228506	0.943	Malectin
12	9606.ENSP00000295682	0.940	Keratinocyte-associated protein 2
13	9606.ENSP00000317331	0.928	Translocon-associated protein subunit delta
14	9606.ENSP00000243253	0.926	Protein transport protein Sec61 subunit alpha isoform 1
15	9606.ENSP00000426167	0.923	Oligosaccharyltransferase complex subunit OSTC
16	9606.ENSP00000361625	0.906	Dolichyldiphosphatase 1
17	9606.ENSP00000310120	0.901	Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
18	9606.ENSP00000251047	0.885	Protein ERGIC-53
19	9606.ENSP00000381237	0.877	Histocompatibility minor 13
20	9606.ENSP00000318147	0.849	ER degradation-enhancing alpha-mannosidase-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004579	1.000	dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006486	0.997	protein glycosylation
GO:0006487	0.988	protein N-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane
GO:0098796	0.999	membrane protein complex
GO:0140534	0.998	endoplasmic reticulum protein-containing complex
GO:1990234	0.995	transferase complex
GO:0008250	0.985	oligosaccharyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22980	1.000	a dolichyl diphosphooligosaccharide + L-asparaginyl-[protein] = a dolichyl diphosphate + H(+) + N(4)-(oligosaccharide-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl)-L-asparaginy-[protein]
EC:2.4.99.18	1.000	dolichyl-diphosphooligosaccharide--protein glycotransferase.

[back to server]