StarFunc result for job id Q8TCN5

User Input

>input (953 residues)
MEESSSVAMLVPDIGEQEAILTAESIISPSLEIDEQRKTKPDPLIHVIQKLSKIVENEKS
QKCLLIGKKRPRSSAATHSLETQELCEIPAKVIQSPAADTRRAEMSQTNFTPDTLAQNEG
KAMSYQCSLCKFLSSSFSVLKDHIKQHGQQNEVILMCSECHITSRSQEELEAHVVNDHDN
DANIHTQSKAQQCVSPSSSLCRKTTERNETIPDIPVSVDNLQTHTVQTASVAEMGRRKWY
AYEQYGMYRCLFCSYTCGQQRMLKTHAWKHAGEVDCSYPIFENENEPLGLLDSSAAAAPG
GVDAVVIAIGESELSIHNGPSVQVQICSSEQLSSSSPLEQSAERGVHLSQSVTLDPNEEE
MLEVISDAEENLIPDSLLTSAQKIISSSPNKKGHVNVIVERLPSAEETLSQKRFLMNTEM
EEGKDLSLTEAQIGREGMDDVYRADKCTVDIGGLIIGWSSSEKKDELMNKGLATDENAPP
GRRRTNSESLRLHSLAAEALVTMPIRAAELTRANLGHYGDINLLDPDTSQRQVDSTLAAY
SKMMSPLKNSSDGLTSLNQSNSTLVALPEGRQELSDGQVKTGISMSLLTVIEKLRERTDQ
NASDDDILKELQDNAQCQPNSDTSLSGNNVVEYIPNAERPYRCRLCHYTSGNKGYIKQHL
RVHRQRQPYQCPICEHIADNSKDLESHMIHHCKTRIYQCKQCEESFHYKSQLRNHEREQH
SLPDTLSIATSNEPRISSDTADGKCVQEGNKSSVQKQYRCDVCDYTSTTYVGVRNHRRIH
NSDKPYRCSLCGYVCSHPPSLKSHMWKHASDQNYNYEQVNKAINDAISQSGRVLGKSPGK
TQLKSSEESADPVTGSSENAVSSSELMSQTPSEVLGTNENEKLSPTSNTSYSLEKISSLA
PPSMEYCVLLFCCCICGFESTSKENLLDHMKEHEGEIVNIILNKDHNTALNTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VEW6	0.082	0.083	9.034E-8	924	0.136	0.141	Q9VEW6.pdb.gz	Q9VEW6_DROME IP01015p OS=Drosophila melanogaster OX=7227 GN=pad PE=2 SV=2
2	AFDB:A2A5K6	0.083	0.065	5.618E-7	1337	0.132	0.094	A2A5K6.pdb.gz	ZN335_MOUSE Zinc finger protein 335 OS=Mus musculus OX=10090 GN=Znf335 PE=1 SV=1
3	AFDB:Q5BIH1	0.069	0.078	6.744E-7	803	0.137	0.163	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
4	AFDB:Q9HCE3	0.055	0.047	1.334E-5	1301	0.164	0.120	Q9HCE3.pdb.gz	ZN532_HUMAN Zinc finger protein 532 OS=Homo sapiens OX=9606 GN=ZNF532 PE=1 SV=2
5	AFDB:Q0E8J0	0.058	0.053	2.044E-5	1152	0.157	0.130	Q0E8J0.pdb.gz	Q0E8J0_DROME MEP-1, isoform A OS=Drosophila melanogaster OX=7227 GN=MEP-1 PE=1 SV=1
6	AFDB:P47043	0.075	0.077	3.328E-5	880	0.126	0.136	P47043.pdb.gz	ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZAP1 PE=1 SV=1
7	AFDB:Q4WJ81	0.056	0.065	4.246E-5	754	0.122	0.154	Q4WJ81.pdb.gz	CRZA_ASPFU C2H2 finger domain transcription factor crzA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=crzA PE=1 SV=1
8	AFDB:P33749	0.056	0.074	1.947E-4	630	0.102	0.154	P33749.pdb.gz	MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSN4 PE=1 SV=1
9	AFDB:B9WEF9	0.073	0.092	3.369E-4	708	0.103	0.138	B9WEF9.pdb.gz	B9WEF9_CANDC Transcriptional regulator, putative OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) OX=573826 GN=CRZ1 PE=4 SV=1
10	AFDB:Q96JM3	0.058	0.066	1.008E-3	812	0.123	0.144	Q96JM3.pdb.gz	CHAP1_HUMAN Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2
11	PDB:3w5kB	0.047	0.243	4.441E-2	110	0.026	0.227	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4fjcE	0.037	0.072	6.096E-1	434	0.016	0.035	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
13	PDB:3gn5A	0.033	0.180	1.520	132	0.008	0.061	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
14	PDB:7oqyY	0.024	0.178	1.825	92	0.010	0.109	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
15	PDB:5iy7M	0.025	0.065	3.791	310	0.013	0.039	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
16	PDB:4btsA9	0.032	0.174	4.029	93	0.009	0.097	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
17	PDB:6hivCb	0.048	0.126	4.029	252	0.010	0.040	6hivCb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
18	PDB:1kx5A	0.035	0.164	4.551	135	0.010	0.074	1kx5A.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
19	PDB:5aj0Ao	0.018	0.089	4.837	105	0.010	0.095	5aj0Ao.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
20	PDB:3javA	0.058	0.033	5.464	2327	0.126	0.052	3javA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99KE8	2.52e-19	95.5	643	0.052	0.078	ZFP64_MOUSE Zinc finger protein 64 OS=Mus musculus OX=10090 GN=Zfp64 PE=1 SV=1
2	P17141	2.64e-18	92.0	594	0.066	0.106	ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus OX=10090 GN=Zfp37 PE=2 SV=4
3	Q96NG5	4.06e-18	90.1	402	0.069	0.164	ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens OX=9606 GN=ZNF558 PE=1 SV=1
4	Q9NTW7	4.71e-18	91.7	645	0.051	0.076	ZF64B_HUMAN Zinc finger protein 64 OS=Homo sapiens OX=9606 GN=ZFP64 PE=1 SV=3
5	Q68DY9	6.34e-18	90.5	489	0.061	0.119	ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens OX=9606 GN=ZNF772 PE=1 SV=2
6	Q8NEP9	8.81e-18	90.5	628	0.059	0.089	ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens OX=9606 GN=ZNF555 PE=1 SV=4
7	Q9UJL9	9.21e-18	90.1	534	0.056	0.099	ZF69B_HUMAN Zinc finger protein 69 homolog B OS=Homo sapiens OX=9606 GN=ZFP69B PE=1 SV=2
8	Q5DTF8	9.57e-18	91.3	919	0.062	0.064	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
9	P51814	1.28e-17	90.5	821	0.088	0.102	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
10	A0A1Y7VLS7	1.34e-17	87.0	312	0.062	0.189	A0A1Y7VLS7_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
11	Q93560	2.05e-17	89.7	817	0.055	0.064	BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=blmp-1 PE=1 SV=1
12	Q3UT31	2.44e-17	86.3	312	0.062	0.189	Q3UT31_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Platr25 PE=2 SV=1
13	A2A9J5	3.08e-17	89.0	645	0.066	0.098	A2A9J5_MOUSE Zinc finger protein 980 OS=Mus musculus OX=10090 GN=Zfp980 PE=4 SV=1
14	Q4VA13	3.45e-17	88.6	630	0.066	0.100	Q4VA13_MOUSE OTTMUSG00000011070 protein OS=Mus musculus OX=10090 GN=Zfp980 PE=2 SV=1
15	Q9BX82	3.48e-17	88.6	626	0.058	0.088	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
16	Q3V1X2	4.59e-17	89.0	888	0.062	0.066	Q3V1X2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
17	P51522	6.84e-17	87.4	516	0.083	0.153	ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens OX=9606 GN=ZNF83 PE=2 SV=3
18	Q8N988	8.31e-17	86.3	423	0.067	0.151	ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens OX=9606 GN=ZNF557 PE=1 SV=2
19	Q8NA42	9.15e-17	86.7	475	0.064	0.128	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
20	Q7TPL6	9.49e-17	87.8	888	0.063	0.068	Q7TPL6_MOUSE Zinc finger protein 748 OS=Mus musculus OX=10090 GN=Zfp748 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16798 DUF5069	36	15.9	Domain of unknown function (DUF5069)
2	PF00096 zf-C2H2	2e-09	48.5	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	8e-09	46.6	C2H2-type zinc finger
4	PF16278 zf-C2HE	34	16.3	C2HE / C2H2 / C2HC zinc-binding finger
5	PF05207 zf-CSL	52	15.0	CSL zinc finger
6	PF13465 zf-H2C2_2	1.3e-07	42.9	Zinc-finger double domain
7	PF13909 zf-H2C2_5	1.4	20.0	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312277

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000395538	0.744	Trinucleotide repeat-containing gene 18 protein
2	9606.ENSP00000316628	0.727	E3 ubiquitin-protein ligase RNF152
3	9606.ENSP00000265857	0.721	Golgi to ER traffic protein 4 homolog
4	9606.ENSP00000327889	0.716	Integrator complex subunit 5
5	9606.ENSP00000313811	0.682	Ubiquitin carboxyl-terminal hydrolase 20
6	9606.ENSP00000265239	0.676	IQ domain-containing protein G
7	9606.ENSP00000379377	0.672	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
8	9606.ENSP00000283243	0.664	Secretory phospholipase A2 receptor
9	9606.ENSP00000240587	0.622	Teashirt homolog 3
10	9606.ENSP00000341564	0.609	Membrane progestin receptor epsilon
11	9606.ENSP00000299642	0.578	C-type lectin domain family 3 member A
12	9606.ENSP00000359401	0.553	Uncharacterized protein C1orf146
13	9606.ENSP00000255152	0.540	Zinc finger SWIM-type containing 3
14	9606.ENSP00000351490	0.521	Protein max
15	9606.ENSP00000402527	0.505	Sentrin-specific protease 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140110	0.992	transcription regulator activity
GO:0097159	0.919	organic cyclic compound binding
GO:0003677	0.901	DNA binding
GO:0003700	0.848	DNA-binding transcription factor activity
GO:0000981	0.727	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.622	sequence-specific double-stranded DNA binding
GO:0000977	0.478	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.428	cis-regulatory region sequence-specific DNA binding
GO:0046872	0.408	metal ion binding
GO:0008270	0.333	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.986	regulation of metabolic process
GO:0051171	0.954	regulation of nitrogen compound metabolic process
GO:0080090	0.951	regulation of primary metabolic process
GO:0031323	0.951	regulation of cellular metabolic process
GO:0019219	0.920	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.904	regulation of macromolecule metabolic process
GO:1903506	0.857	regulation of nucleic acid-templated transcription
GO:0006355	0.851	regulation of DNA-templated transcription
GO:0009987	0.790	cellular process
GO:0048519	0.441	negative regulation of biological process
GO:0048523	0.374	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.733	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]