StarFunc result for job id Q8TCS8

User Input

>input (783 residues)
MAACRYCCSCLRLRPLSDGPFLLPRRDRALTQLQVRALWSSAGSRAVAVDLGNRKLEISS
GKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRRE
IGTSDKEILTSRIIDRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLS
DIPWNGPVGAVRIGIIDGEYVVNPTRKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQD
FCHAIKVGVKYTQQIIQGIQQLVKETGVTKRTPQKLFTPSPEIVKYTHKLAMERLYAVFT
DYEHDKVSRDEAVNKIRLDTEEQLKEKFPEADPYEIIESFNVVAKEVFRSIVLNEYKRCD
GRDLTSLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGIKD
KNFMLHYEFPPYATNEIGKVTGLNRRELGHGALAEKALYPVIPRDFPFTIRVTSEVLESN
GSSSMASACGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIEDYN
GDMDFKIAGTNKGITALQADIKLPGIPIKIVMEAIQQASVAKKEILQIMNKTISKPRASR
KENGPVVETVQVPLSKRAKFVGPGGYNLKKLQAETGVTISQVDEETFSVFAPTPSAMHEA
RDFITEICKDDQEQQLEFGAVYTATITEIRDTGVMVKLYPNMTAVLLHNTQLDQRKIKHP
TALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQSPATTVVRTLNDRSSIVMGEPISQSSS
NSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V6G7	0.888	0.887	0.000	784	0.916	0.915	G3V6G7.pdb.gz	G3V6G7_RAT polyribonucleotide nucleotidyltransferase OS=Rattus norvegicus OX=10116 GN=Pnpt1 PE=3 SV=1
2	AFDB:Q5U1D1	0.868	0.881	1.127E-98	771	0.542	0.550	Q5U1D1.pdb.gz	Q5U1D1_DROME polyribonucleotide nucleotidyltransferase OS=Drosophila melanogaster OX=7227 GN=PNPase PE=2 SV=1
3	AFDB:Q9S7G6	0.765	0.609	2.169E-78	991	0.379	0.300	Q9S7G6.pdb.gz	PNP2_ARATH Polyribonucleotide nucleotidyltransferase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PNP2 PE=1 SV=1
4	AFDB:Q3IJ73	0.746	0.819	1.114E-71	708	0.346	0.383	Q3IJ73.pdb.gz	PNP_PSET1 Polyribonucleotide nucleotidyltransferase OS=Pseudoalteromonas translucida (strain TAC 125) OX=326442 GN=pnp PE=1 SV=1
5	AFDB:P50849	0.726	0.803	2.364E-71	705	0.333	0.370	P50849.pdb.gz	PNP_BACSU Polyribonucleotide nucleotidyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=pnp PE=1 SV=3
6	AFDB:Q1ZJW2	0.743	0.815	2.485E-71	708	0.333	0.369	Q1ZJW2.pdb.gz	Q1ZJW2_PHOAS Polyribonucleotide nucleotidyltransferase OS=Photobacterium angustum (strain S14 / CCUG 15956) OX=314292 GN=pnp PE=1 SV=1
7	AFDB:P05055	0.745	0.815	2.889E-71	711	0.355	0.391	P05055.pdb.gz	PNP_ECOLI Polyribonucleotide nucleotidyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=pnp PE=1 SV=3
8	AFDB:Q9RSR1	0.703	0.707	8.285E-71	779	0.337	0.339	Q9RSR1.pdb.gz	PNP_DEIRA Polyribonucleotide nucleotidyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=pnp PE=1 SV=2
9	AFDB:Q8GZQ3	0.717	0.614	1.081E-67	922	0.337	0.286	Q8GZQ3.pdb.gz	PNP1_ARATH Polyribonucleotide nucleotidyltransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNP1 PE=1 SV=1
10	AFDB:P9WI57	0.708	0.736	1.328E-66	752	0.315	0.328	P9WI57.pdb.gz	PNP_MYCTU Polyribonucleotide nucleotidyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pnp PE=1 SV=1
11	PDB:7ogkA	0.695	0.778	7.961E-65	695	0.355	0.400	7ogkA.pdb.gz	A cooperative PNPase-Hfq-RNA carrier complex facilitates bacterial riboregulation.
12	PDB:3cdiA	0.617	0.923	2.698E-51	516	0.287	0.436	3cdiA.pdb.gz
13	PDB:2c39D	0.246	0.740	1.709E-13	248	0.078	0.246	2c39D.pdb.gz	Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
14	PDB:6d6qF	0.249	0.746	1.889E-13	252	0.060	0.187	6d6qF.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
15	PDB:2wnrB	0.251	0.851	3.449E-13	222	0.073	0.257	2wnrB.pdb.gz	Structure of the Methanothermobacter Thermautotrophicus Exosome Rnase Ph Ring
16	PDB:1oyrA	0.244	0.752	1.040E-12	242	0.068	0.219	1oyrA.pdb.gz
17	PDB:4ba2A	0.258	0.691	3.833E-12	274	0.064	0.182	4ba2A.pdb.gz	Crystal Structure of a 9-Subunit Archaeal Exosome in Pre-Catalytic States of the Phosphorolytic Reaction.
18	PDB:6d6qB	0.256	0.794	4.925E-12	241	0.059	0.191	6d6qB.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
19	PDB:5c0xB	0.248	0.747	5.205E-11	244	0.056	0.180	5c0xB.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
20	PDB:3l7zA	0.245	0.710	6.362E-11	251	0.064	0.199	3l7zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZRL9	0.0	1353	775	0.857	0.866	A0A8I5ZRL9_RAT polyribonucleotide nucleotidyltransferase OS=Rattus norvegicus OX=10116 GN=Pnpt1 PE=1 SV=1
2	B1H2A4	0.0	731	383	0.443	0.906	B1H2A4_RAT polyribonucleotide nucleotidyltransferase (Fragment) OS=Rattus norvegicus OX=10116 GN=Pnpt1 PE=2 SV=1
3	G3V6G7	0.0	1439	784	0.891	0.890	G3V6G7_RAT polyribonucleotide nucleotidyltransferase OS=Rattus norvegicus OX=10116 GN=Pnpt1 PE=3 SV=1
4	Q562B9	0.0	871	452	0.526	0.912	Q562B9_RAT polyribonucleotide nucleotidyltransferase (Fragment) OS=Rattus norvegicus OX=10116 GN=Pnpt1 PE=2 SV=1
5	Q5U1D1	0.0	867	771	0.538	0.546	Q5U1D1_DROME polyribonucleotide nucleotidyltransferase OS=Drosophila melanogaster OX=7227 GN=PNPase PE=2 SV=1
6	Q8IH29	0.0	790	717	0.480	0.524	Q8IH29_DROME polyribonucleotide nucleotidyltransferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=PNPase PE=2 SV=1
7	Q8K1R3	0.0	1446	783	0.894	0.894	PNPT1_MOUSE Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Pnpt1 PE=1 SV=1
8	Q8TCS8	0.0	1613	783	1.000	1.000	PNPT1_HUMAN Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2
9	Q95RX7	0.0	864	720	0.529	0.575	Q95RX7_DROME polyribonucleotide nucleotidyltransferase OS=Drosophila melanogaster OX=7227 GN=PNPase PE=2 SV=1
10	Q9V9X7	0.0	868	771	0.539	0.547	Q9V9X7_DROME polyribonucleotide nucleotidyltransferase OS=Drosophila melanogaster OX=7227 GN=PNPase PE=2 SV=2
11	Q9S7G6	1.34e-172	525	991	0.372	0.294	PNP2_ARATH Polyribonucleotide nucleotidyltransferase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PNP2 PE=1 SV=1
12	Q3IJ73	3.93e-154	468	708	0.352	0.390	PNP_PSET1 Polyribonucleotide nucleotidyltransferase OS=Pseudoalteromonas translucida (strain TAC 125) OX=326442 GN=pnp PE=1 SV=1
13	P05055	1.00e-153	467	711	0.359	0.395	PNP_ECOLI Polyribonucleotide nucleotidyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=pnp PE=1 SV=3
14	Q9RSR1	2.17e-149	458	779	0.340	0.341	PNP_DEIRA Polyribonucleotide nucleotidyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=pnp PE=1 SV=2
15	Q1ZJW2	1.28e-147	451	708	0.344	0.380	Q1ZJW2_PHOAS Polyribonucleotide nucleotidyltransferase OS=Photobacterium angustum (strain S14 / CCUG 15956) OX=314292 GN=pnp PE=1 SV=1
16	P50849	1.18e-145	446	705	0.331	0.367	PNP_BACSU Polyribonucleotide nucleotidyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=pnp PE=1 SV=3
17	O51745	5.08e-135	418	716	0.313	0.342	PNP_BORBU Polyribonucleotide nucleotidyltransferase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=pnp PE=3 SV=2
18	P9WI57	9.05e-122	385	752	0.319	0.332	PNP_MYCTU Polyribonucleotide nucleotidyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pnp PE=1 SV=1
19	Q8GZQ3	1.38e-118	381	922	0.323	0.274	PNP1_ARATH Polyribonucleotide nucleotidyltransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PNP1 PE=1 SV=1
20	Q9UXC2	2.76e-14	75.5	248	0.077	0.242	RRP41_SACS2 Exosome complex component Rrp41 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=rrp41 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00013 KH_1	9.4e-05	33.5	KH domain
2	PF03726 PNPase	0.00014	33.6	Polyribonucleotide nucleotidyltransferase, RNA binding domain
3	PF01138 RNase_PH	1.9e-36	136.9	3' exoribonuclease family, domain 1
4	PF03725 RNase_PH_C	5.2e-14	63.3	3' exoribonuclease family, domain 2
5	PF00575 S1	0.2	23.4	S1 RNA binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400646

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352678	0.999	ATP-dependent RNA helicase SUPV3L1, mitochondrial
2	9606.ENSP00000311677	0.990	Nuclear inhibitor of protein phosphatase 1
3	9606.ENSP00000315476	0.973	Exosome complex component RRP41
4	9606.ENSP00000366997	0.973	Exosome complex exonuclease RRP44
5	9606.ENSP00000265564	0.966	Exosome complex component RRP42
6	9606.ENSP00000359939	0.966	Exosome complex component CSL4
7	9606.ENSP00000366135	0.963	Exosome component 10
8	9606.ENSP00000221233	0.962	Exosome complex component RRP46
9	9606.ENSP00000368984	0.960	Exosome complex component RRP45
10	9606.ENSP00000398597	0.960	Exosome complex component MTR3
11	9606.ENSP00000374354	0.957	Exosome complex component RRP43
12	9606.ENSP00000323046	0.955	Exosome complex component RRP40
13	9606.ENSP00000321711	0.945	DIS3-like exonuclease 1
14	9606.ENSP00000361433	0.939	Exosome complex component RRP4
15	9606.ENSP00000348107	0.929	Nuclear nucleic acid-binding protein C1D
16	9606.ENSP00000368017	0.915	Zinc finger C3H1 domain-containing protein
17	9606.ENSP00000258169	0.901	M-phase phosphoprotein 6
18	9606.ENSP00000254799	0.857	G-rich sequence factor 1
19	9606.ENSP00000356416	0.856	60 kDa SS-A/Ro ribonucleoprotein
20	9606.ENSP00000249269	0.852	Mitochondrial-processing peptidase subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004654	0.999	polyribonucleotide nucleotidyltransferase activity
GO:0005488	0.995	binding
GO:0005515	0.988	protein binding
GO:0003723	0.931	RNA binding
GO:0140098	0.893	catalytic activity, acting on RNA
GO:0016787	0.828	hydrolase activity
GO:0004540	0.656	ribonuclease activity
GO:0004532	0.649	exoribonuclease activity
GO:0008408	0.630	3'-5' exonuclease activity
GO:0000175	0.620	3'-5'-RNA exonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.955	biological regulation
GO:0071704	0.954	organic substance metabolic process
GO:0044237	0.952	cellular metabolic process
GO:0050789	0.948	regulation of biological process
GO:0010468	0.938	regulation of gene expression
GO:0006807	0.934	nitrogen compound metabolic process
GO:0050794	0.928	regulation of cellular process
GO:0006401	0.922	RNA catabolic process
GO:0031323	0.907	regulation of cellular metabolic process
GO:0010467	0.857	gene expression
GO:0048518	0.845	positive regulation of biological process
GO:0048522	0.843	positive regulation of cellular process
GO:0010604	0.828	positive regulation of macromolecule metabolic process
GO:0051171	0.806	regulation of nitrogen compound metabolic process
GO:0080090	0.798	regulation of primary metabolic process
GO:0061014	0.781	positive regulation of mRNA catabolic process
GO:0048519	0.588	negative regulation of biological process
GO:0050896	0.578	response to stimulus
GO:0006396	0.416	RNA processing
GO:0032502	0.387	developmental process
GO:0048856	0.375	anatomical structure development
GO:0071840	0.360	cellular component organization or biogenesis
GO:0042221	0.344	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0070013	0.999	intracellular organelle lumen
GO:0005634	0.996	nucleus
GO:0016020	0.994	membrane
GO:0005739	0.993	mitochondrion
GO:0031981	0.990	nuclear lumen
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:1902494	0.976	catalytic complex
GO:0031975	0.975	envelope
GO:0031967	0.972	organelle envelope
GO:0005829	0.965	cytosol
GO:0031090	0.965	organelle membrane
GO:1990904	0.941	ribonucleoprotein complex
GO:0005740	0.929	mitochondrial envelope
GO:0012505	0.922	endomembrane system
GO:0005840	0.868	ribosome
GO:0005654	0.782	nucleoplasm
GO:0031984	0.781	organelle subcompartment
GO:0005844	0.770	polysome
GO:0031970	0.765	organelle envelope lumen
GO:0005783	0.756	endoplasmic reticulum
GO:0042175	0.728	nuclear outer membrane-endoplasmic reticulum membrane network
GO:1905354	0.689	exoribonuclease complex
GO:0005758	0.641	mitochondrial intermembrane space
GO:0005759	0.560	mitochondrial matrix
GO:0098827	0.533	endoplasmic reticulum subcompartment
GO:0042788	0.483	polysomal ribosome
GO:0005789	0.465	endoplasmic reticulum membrane
GO:0000178	0.419	exosome (RNase complex)
GO:0005730	0.382	nucleolus
GO:0044391	0.342	ribosomal subunit
GO:0031966	0.341	mitochondrial membrane
GO:0005743	0.332	mitochondrial inner membrane
GO:0098796	0.325	membrane protein complex
GO:0000177	0.317	cytoplasmic exosome (RNase complex)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22096	0.999	phosphate + RNA(n+1) = a ribonucleoside 5'-diphosphate + RNA(n)
EC:2.7.7.8	0.999	polyribonucleotide nucleotidyltransferase.
EC:3.-.-.-	0.828	Hydrolases.
EC:3.1.-.-	0.656	Acting on ester bonds.
EC:3.1.13.-	0.620	Exoribonucleases producing 5'-phosphomonoesters.

[back to server]