StarFunc result for job id Q8TCT7

User Input

>input (592 residues)
MAAAVAAALARLLAAFLLLAAQVACEYGMVHVVSQAGGPEGKDYCILYNPQWAHLPHDLS
KASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSR
ERLVPPGGNKTQYDEIGIPVALLSYKDMLDIFTRFGRTVRAALYAPKEPVLDYNMVIIFI
MAVGTVAIGGYWAGSRDVKKRYMKHKRDDGPEKQEDEAVDVTPVMTCVFVVMCCSMLVLL
YYFYDLLVYVVIGIFCLASATGLYSCLAPCVRRLPFGKCRIPNNSLPYFHKRPQARMLLL
ALFCVAVSVVWGVFRNEDQWAWVLQDALGIAFCLYMLKTIRLPTFKACTLLLLVLFLYDI
FFVFITPFLTKSGSSIMVEVATGPSDSATREKLPMVLKVPRLNSSPLALCDRPFSLLGFG
DILVPGLLVAYCHRFDIQVQSSRVYFVACTIAYGVGLLVTFVALALMQRGQPALLYLVPC
TLVTSCAVALWRRELGVFWTGSGFAKVLPPSPWAPAPADGPQPPKDSATPLSPQPPSEEP
ATSPWPAEQSPKSRTSEEMGAGAPMREPGSPAESEGRDQAQPSPVTQPGASA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TCT7	0.999	0.999	4.197E-92	592	1.000	1.000	Q8TCT7.pdb.gz	SPP2B_HUMAN Signal peptide peptidase-like 2B OS=Homo sapiens OX=9606 GN=SPPL2B PE=1 SV=2
2	AFDB:Q5BP99	0.828	0.868	1.170E-67	564	0.650	0.683	Q5BP99.pdb.gz
3	AFDB:A2A6C4	0.774	0.668	3.162E-50	690	0.493	0.423	A2A6C4.pdb.gz	SPP2C_MOUSE Signal peptide peptidase-like 2C OS=Mus musculus OX=10090 GN=Sppl2c PE=1 SV=1
4	AFDB:Q8IUH8	0.733	0.639	4.891E-49	684	0.470	0.406	Q8IUH8.pdb.gz	SPP2C_HUMAN Signal peptide peptidase-like 2C OS=Homo sapiens OX=9606 GN=SPPL2C PE=1 SV=3
5	AFDB:Q8TCT8	0.767	0.870	4.500E-48	520	0.397	0.452	Q8TCT8.pdb.gz	SPP2A_HUMAN Signal peptide peptidase-like 2A OS=Homo sapiens OX=9606 GN=SPPL2A PE=1 SV=2
6	AFDB:Q9JJF9	0.753	0.846	2.612E-46	523	0.383	0.434	Q9JJF9.pdb.gz	SPP2A_MOUSE Signal peptide peptidase-like 2A OS=Mus musculus OX=10090 GN=Sppl2a PE=1 SV=2
7	AFDB:F4I3Q0	0.684	0.745	3.562E-31	540	0.253	0.278	F4I3Q0.pdb.gz	F4I3Q0_ARATH SIGNAL PEPTIDE PEPTIDASE-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=SPPL2 PE=1 SV=1
8	AFDB:Q9VPQ7	0.455	0.673	2.100E-15	389	0.157	0.239	Q9VPQ7.pdb.gz	Q9VPQ7_DROME SD07518p OS=Drosophila melanogaster OX=7227 GN=Spp PE=1 SV=1
9	AFDB:B9FJ61	0.432	0.727	9.976E-15	343	0.145	0.251	B9FJ61.pdb.gz	SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=SPP2 PE=2 SV=1
10	AFDB:O81062	0.425	0.712	1.388E-14	344	0.144	0.247	O81062.pdb.gz	SIP_ARATH Signal peptide peptidase OS=Arabidopsis thaliana OX=3702 GN=SPP PE=2 SV=1
11	PDB:6idfB	0.337	0.587	4.231E-6	312	0.100	0.189	6idfB.pdb.gz	Structural basis of Notch recognition by human gamma-secretase
12	PDB:5fn3B	0.302	0.559	4.986E-4	286	0.088	0.182	5fn3B.pdb.gz	Sampling the conformational space of the catalytic subunit of human gamma-secretase.
13	PDB:7zqsB	0.149	0.139	2.861E-3	639	0.046	0.042	7zqsB.pdb.gz	Discovery of a Transferrin Receptor 1-Binding Aptamer and Its Application in Cancer Cell Depletion for Adoptive T-Cell Therapy Manufacturing.
14	PDB:5fn5B	0.185	0.398	3.798E-3	223	0.078	0.206	5fn5B.pdb.gz
15	PDB:4hygB	0.285	0.606	6.694E-3	247	0.073	0.174	4hygB.pdb.gz
16	PDB:7y5xB	0.223	0.549	2.511E-2	211	0.068	0.190	7y5xB.pdb.gz	Molecular basis for isoform-selective inhibition of presenilin-1 by MRK-560.
17	PDB:4tweA	0.145	0.124	1.035E-1	706	0.042	0.035	4tweA.pdb.gz	Structural and biochemical characterization of a novel aminopeptidase from human intestine.
18	PDB:3fedA	0.152	0.133	1.193E-1	690	0.044	0.038	3fedA.pdb.gz	Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III
19	PDB:6etyA	0.155	0.134	1.193E-1	696	0.042	0.036	6etyA.pdb.gz	Structural and computational basis for potent inhibition of glutamate carboxypeptidase II by carbamate-based inhibitors.
20	PDB:2c5qE	0.079	0.183	1.311E-1	233	0.041	0.103	2c5qE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WZ50	0.0	606	291	0.492	1.000	A0A087WZ50_HUMAN Signal peptide peptidase like 2B OS=Homo sapiens OX=9606 GN=SPPL2B PE=1 SV=1
2	F1QYI0	0.0	802	555	0.660	0.705	F1QYI0_DANRE Signal peptide peptidase-like 2 OS=Danio rerio OX=7955 GN=SPPL2B PE=1 SV=1
3	Q8TCT7	0.0	1205	592	1.000	1.000	SPP2B_HUMAN Signal peptide peptidase-like 2B OS=Homo sapiens OX=9606 GN=SPPL2B PE=1 SV=2
4	A2A6C4	8.24e-167	493	690	0.485	0.416	SPP2C_MOUSE Signal peptide peptidase-like 2C OS=Mus musculus OX=10090 GN=Sppl2c PE=1 SV=1
5	Q8TCT8	1.09e-160	471	520	0.402	0.458	SPP2A_HUMAN Signal peptide peptidase-like 2A OS=Homo sapiens OX=9606 GN=SPPL2A PE=1 SV=2
6	Q9JJF9	4.06e-156	459	523	0.389	0.440	SPP2A_MOUSE Signal peptide peptidase-like 2A OS=Mus musculus OX=10090 GN=Sppl2a PE=1 SV=2
7	Q8IUH8	7.27e-151	452	684	0.481	0.417	SPP2C_HUMAN Signal peptide peptidase-like 2C OS=Homo sapiens OX=9606 GN=SPPL2C PE=1 SV=3
8	A0A087WT77	4.64e-115	341	165	0.277	0.994	A0A087WT77_HUMAN Signal peptide peptidase like 2B (Fragment) OS=Homo sapiens OX=9606 GN=SPPL2B PE=1 SV=6
9	H0YNA2	2.49e-109	333	356	0.285	0.475	H0YNA2_HUMAN Signal peptide peptidase like 2A (Fragment) OS=Homo sapiens OX=9606 GN=SPPL2A PE=1 SV=1
10	Q8W469	7.79e-63	218	540	0.260	0.285	SIPL2_ARATH Signal peptide peptidase-like 2 OS=Arabidopsis thaliana OX=3702 GN=SPPL2 PE=2 SV=1
11	F4I3Q0	3.14e-62	216	540	0.258	0.283	F4I3Q0_ARATH SIGNAL PEPTIDE PEPTIDASE-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=SPPL2 PE=1 SV=1
12	Q4V3B8	4.84e-62	216	540	0.294	0.322	SIPL3_ARATH Signal peptide peptidase-like 3 OS=Arabidopsis thaliana OX=3702 GN=SPPL3 PE=2 SV=1
13	P49049	1.22e-24	109	468	0.108	0.137	IMP2_CAEEL Intramembrane protease 2 OS=Caenorhabditis elegans OX=6239 GN=imp-2 PE=1 SV=1
14	B9FJ61	3.62e-24	106	343	0.108	0.187	SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=SPP2 PE=2 SV=1
15	Q6ZGL9	3.72e-24	106	343	0.108	0.187	SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=SPP1 PE=2 SV=1
16	Q9VPQ7	1.01e-23	105	389	0.152	0.231	Q9VPQ7_DROME SD07518p OS=Drosophila melanogaster OX=7227 GN=Spp PE=1 SV=1
17	O81062	4.68e-23	102	344	0.101	0.174	SIP_ARATH Signal peptide peptidase OS=Arabidopsis thaliana OX=3702 GN=SPP PE=2 SV=1
18	Q5BP97	8.63e-23	102	382	0.133	0.207	Q5BP97_DANRE Signal peptide peptidase 3 OS=Danio rerio OX=7955 GN=fb94d08 PE=2 SV=1
19	Q9VBL1	2.65e-22	102	417	0.166	0.235	Q9VBL1_DROME FI17310p1 OS=Drosophila melanogaster OX=7227 GN=SppL PE=2 SV=1
20	P34248	2.79e-22	103	587	0.115	0.116	YKK0_YEAST Probable intramembrane protease YKL100C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKL100C PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11833 CPP1-like	20	16.3	Protein CHAPERONE-LIKE PROTEIN OF POR1-like
2	PF02225 PA	4.4e-05	34.8	PA domain
3	PF04258 Peptidase_A22B	4.1e-84	294.0	Signal peptide peptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478298

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398698	0.908	Tumor necrosis factor
2	9606.ENSP00000338034	0.750	SPRY domain containing 4
3	9606.ENSP00000429015	0.700	Ankyrin repeat domain-containing protein 46
4	9606.ENSP00000483453	0.654	Synergin gamma
5	9606.ENSP00000367828	0.649	Integral membrane protein 2B
6	9606.ENSP00000260372	0.579	HAUS augmin-like complex subunit 2
7	9606.ENSP00000383911	0.575	Ubiquitin-associated domain-containing protein 2
8	9606.ENSP00000465213	0.532	Ribonuclease P protein subunit p29
9	9606.ENSP00000215071	0.519	26S proteasome non-ATPase regulatory subunit 8
10	9606.ENSP00000353538	0.518	Leucine-rich repeat and coiled-coil domain-containing protein 1
11	9606.ENSP00000381895	0.518	Single-pass membrane protein with coiled-coil domains 3
12	9606.ENSP00000372193	0.511	H(+)/Cl(-) exchange transporter 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0004190	1.000	aspartic-type endopeptidase activity
GO:0042500	0.994	aspartic endopeptidase activity, intramembrane cleaving

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.992	biological regulation
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.982	primary metabolic process
GO:0050789	0.980	regulation of biological process
GO:0006807	0.936	nitrogen compound metabolic process
GO:1901564	0.910	organonitrogen compound metabolic process
GO:0043170	0.903	macromolecule metabolic process
GO:0050794	0.893	regulation of cellular process
GO:0019538	0.881	protein metabolic process
GO:0033619	0.868	membrane protein proteolysis
GO:0002682	0.737	regulation of immune system process
GO:0048583	0.691	regulation of response to stimulus
GO:0023051	0.597	regulation of signaling
GO:0010646	0.597	regulation of cell communication
GO:0001959	0.588	regulation of cytokine-mediated signaling pathway
GO:0010803	0.550	regulation of tumor necrosis factor-mediated signaling pathway
GO:0050776	0.509	regulation of immune response
GO:0009987	0.418	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0071944	0.998	cell periphery
GO:0030659	0.996	cytoplasmic vesicle membrane
GO:0098588	0.995	bounding membrane of organelle
GO:0070013	0.994	intracellular organelle lumen
GO:0005789	0.994	endoplasmic reticulum membrane
GO:0005886	0.991	plasma membrane
GO:0005634	0.985	nucleus
GO:0005654	0.975	nucleoplasm
GO:0098554	0.967	cytoplasmic side of endoplasmic reticulum membrane
GO:0043232	0.960	intracellular non-membrane-bounded organelle
GO:0098576	0.959	lumenal side of membrane
GO:0098553	0.954	lumenal side of endoplasmic reticulum membrane
GO:0000323	0.935	lytic vacuole
GO:0005764	0.932	lysosome
GO:0098852	0.877	lytic vacuole membrane
GO:0005765	0.862	lysosomal membrane
GO:0005856	0.839	cytoskeleton
GO:0005798	0.676	Golgi-associated vesicle
GO:0015630	0.668	microtubule cytoskeleton
GO:0005768	0.664	endosome
GO:0005815	0.660	microtubule organizing center
GO:0030660	0.657	Golgi-associated vesicle membrane
GO:0005813	0.634	centrosome
GO:0005576	0.470	extracellular region
GO:0010008	0.439	endosome membrane
GO:0032991	0.402	protein-containing complex
GO:0005615	0.344	extracellular space
GO:0015629	0.322	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.23.-	1.000	Aspartic endopeptidases.

[back to server]