StarFunc result for job id Q8TCT8

User Input

>input (520 residues)
MGPQRRLSPAGAALLWGFLLQLTAAQEAILHASGNGTTKDYCMLYNPYWTALPSTLENAT
SISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVL
FPPSGNRSEFPDVKILIAFISYKDFRDMNQTLGDNITVKMYSPSWPNFDYTMVVIFVIAV
FTVALGGYWSGLVELENLKAVTTEDREMRKKKEEYLTFSPLTVVIFVVICCVMMVLLYFF
YKWLVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTIACRGKNMEVRLIFLSGLCIAVA
VVWAVFRNEDRWAWILQDILGIAFCLNLIKTLKLPNFKSCVILLGLLLLYDVFFVFITPF
ITKNGESIMVELAAGPFGNNEKLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLI
AYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVA
WRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TCT8	1.000	1.000	2.397E-85	520	1.000	1.000	Q8TCT8.pdb.gz	SPP2A_HUMAN Signal peptide peptidase-like 2A OS=Homo sapiens OX=9606 GN=SPPL2A PE=1 SV=2
2	AFDB:Q9JJF9	0.946	0.941	7.184E-71	523	0.802	0.797	Q9JJF9.pdb.gz	SPP2A_MOUSE Signal peptide peptidase-like 2A OS=Mus musculus OX=10090 GN=Sppl2a PE=1 SV=2
3	AFDB:Q8TCT7	0.871	0.768	1.589E-48	592	0.456	0.400	Q8TCT7.pdb.gz	SPP2B_HUMAN Signal peptide peptidase-like 2B OS=Homo sapiens OX=9606 GN=SPPL2B PE=1 SV=2
4	AFDB:Q5BP99	0.863	0.798	2.557E-48	564	0.471	0.434	Q5BP99.pdb.gz
5	AFDB:Q8IUH8	0.823	0.633	1.370E-43	684	0.396	0.301	Q8IUH8.pdb.gz	SPP2C_HUMAN Signal peptide peptidase-like 2C OS=Homo sapiens OX=9606 GN=SPPL2C PE=1 SV=3
6	AFDB:A2A6C4	0.843	0.643	3.382E-43	690	0.413	0.312	A2A6C4.pdb.gz	SPP2C_MOUSE Signal peptide peptidase-like 2C OS=Mus musculus OX=10090 GN=Sppl2c PE=1 SV=1
7	AFDB:F4I3Q0	0.793	0.765	2.038E-32	540	0.263	0.254	F4I3Q0.pdb.gz	F4I3Q0_ARATH SIGNAL PEPTIDE PEPTIDASE-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=SPPL2 PE=1 SV=1
8	AFDB:Q4V3B8	0.744	0.719	2.138E-32	540	0.290	0.280	Q4V3B8.pdb.gz	SIPL3_ARATH Signal peptide peptidase-like 3 OS=Arabidopsis thaliana OX=3702 GN=SPPL3 PE=2 SV=1
9	AFDB:Q8TCT6	0.540	0.720	5.708E-17	384	0.154	0.208	Q8TCT6.pdb.gz	SPPL3_HUMAN Signal peptide peptidase-like 3 OS=Homo sapiens OX=9606 GN=SPPL3 PE=1 SV=2
10	AFDB:Q93Z32	0.549	0.753	1.704E-16	372	0.177	0.247	Q93Z32.pdb.gz	SIPL1_ARATH Signal peptide peptidase-like 1 OS=Arabidopsis thaliana OX=3702 GN=SPPL1 PE=2 SV=1
11	PDB:6idfB	0.371	0.567	3.249E-6	312	0.119	0.199	6idfB.pdb.gz	Structural basis of Notch recognition by human gamma-secretase
12	PDB:5fn3B	0.350	0.588	1.994E-3	286	0.106	0.192	5fn3B.pdb.gz	Sampling the conformational space of the catalytic subunit of human gamma-secretase.
13	PDB:5fn5B	0.174	0.362	7.917E-3	223	0.081	0.188	5fn5B.pdb.gz
14	PDB:7y5xB	0.272	0.609	7.917E-3	211	0.085	0.209	7y5xB.pdb.gz	Molecular basis for isoform-selective inhibition of presenilin-1 by MRK-560.
15	PDB:4hygB	0.340	0.646	1.053E-2	247	0.081	0.170	4hygB.pdb.gz
16	PDB:7zqsB	0.181	0.150	1.616E-2	639	0.052	0.042	7zqsB.pdb.gz	Discovery of a Transferrin Receptor 1-Binding Aptamer and Its Application in Cancer Cell Depletion for Adoptive T-Cell Therapy Manufacturing.
17	PDB:6etyA	0.170	0.131	5.058E-2	696	0.065	0.049	6etyA.pdb.gz	Structural and computational basis for potent inhibition of glutamate carboxypeptidase II by carbamate-based inhibitors.
18	PDB:3fedA	0.118	0.091	1.583E-1	690	0.035	0.026	3fedA.pdb.gz	Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III
19	PDB:4tweA	0.172	0.133	2.008E-1	706	0.058	0.042	4tweA.pdb.gz	Structural and biochemical characterization of a novel aminopeptidase from human intestine.
20	PDB:7lubB	0.072	0.079	2.547E-1	462	0.062	0.069	7lubB.pdb.gz	Protein-metabolite interactomics of carbohydrate metabolism reveal regulation of lactate dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YNA2	0.0	676	356	0.648	0.947	H0YNA2_HUMAN Signal peptide peptidase like 2A (Fragment) OS=Homo sapiens OX=9606 GN=SPPL2A PE=1 SV=1
2	Q8TCT8	0.0	1066	520	1.000	1.000	SPP2A_HUMAN Signal peptide peptidase-like 2A OS=Homo sapiens OX=9606 GN=SPPL2A PE=1 SV=2
3	Q9JJF9	0.0	847	523	0.804	0.799	SPP2A_MOUSE Signal peptide peptidase-like 2A OS=Mus musculus OX=10090 GN=Sppl2a PE=1 SV=2
4	F1QYI0	1.35e-170	495	555	0.462	0.432	F1QYI0_DANRE Signal peptide peptidase-like 2 OS=Danio rerio OX=7955 GN=SPPL2B PE=1 SV=1
5	Q8TCT7	3.85e-166	485	592	0.438	0.385	SPP2B_HUMAN Signal peptide peptidase-like 2B OS=Homo sapiens OX=9606 GN=SPPL2B PE=1 SV=2
6	A2A6C4	2.73e-121	373	690	0.392	0.296	SPP2C_MOUSE Signal peptide peptidase-like 2C OS=Mus musculus OX=10090 GN=Sppl2c PE=1 SV=1
7	Q8IUH8	1.78e-104	329	684	0.394	0.300	SPP2C_HUMAN Signal peptide peptidase-like 2C OS=Homo sapiens OX=9606 GN=SPPL2C PE=1 SV=3
8	A0A087WZ50	8.51e-82	258	291	0.227	0.405	A0A087WZ50_HUMAN Signal peptide peptidase like 2B OS=Homo sapiens OX=9606 GN=SPPL2B PE=1 SV=1
9	Q4V3B8	9.13e-56	197	540	0.262	0.252	SIPL3_ARATH Signal peptide peptidase-like 3 OS=Arabidopsis thaliana OX=3702 GN=SPPL3 PE=2 SV=1
10	Q8W469	1.55e-53	191	540	0.271	0.261	SIPL2_ARATH Signal peptide peptidase-like 2 OS=Arabidopsis thaliana OX=3702 GN=SPPL2 PE=2 SV=1
11	F4I3Q0	5.91e-53	189	540	0.269	0.259	F4I3Q0_ARATH SIGNAL PEPTIDE PEPTIDASE-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=SPPL2 PE=1 SV=1
12	A0A087WT77	4.21e-50	171	165	0.152	0.479	A0A087WT77_HUMAN Signal peptide peptidase like 2B (Fragment) OS=Homo sapiens OX=9606 GN=SPPL2B PE=1 SV=6
13	Q9VPQ7	1.97e-26	113	389	0.187	0.249	Q9VPQ7_DROME SD07518p OS=Drosophila melanogaster OX=7227 GN=Spp PE=1 SV=1
14	P49049	6.64e-25	109	468	0.150	0.167	IMP2_CAEEL Intramembrane protease 2 OS=Caenorhabditis elegans OX=6239 GN=imp-2 PE=1 SV=1
15	O81062	3.63e-24	105	344	0.115	0.174	SIP_ARATH Signal peptide peptidase OS=Arabidopsis thaliana OX=3702 GN=SPP PE=2 SV=1
16	Q93Z32	8.03e-24	105	372	0.171	0.239	SIPL1_ARATH Signal peptide peptidase-like 1 OS=Arabidopsis thaliana OX=3702 GN=SPPL1 PE=2 SV=1
17	Q9UTA3	6.84e-23	100	295	0.169	0.298	YL8H_SCHPO Probable intramembrane protease C25B8.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC25B8.17 PE=3 SV=1
18	Q6IQA7	3.20e-22	100	366	0.156	0.221	Q6IQA7_DANRE Histocompatibility (minor) 13 OS=Danio rerio OX=7955 GN=H13 PE=1 SV=1
19	Q6ZGL9	3.90e-22	99.8	343	0.115	0.175	SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=SPP1 PE=2 SV=1
20	B9FJ61	4.21e-22	99.8	343	0.108	0.163	SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=SPP2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02225 PA	0.025	26.0	PA domain
2	PF04258 Peptidase_A22B	1.3e-75	266.1	Signal peptide peptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261854

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398698	0.912	Tumor necrosis factor
2	9606.ENSP00000367828	0.659	Integral membrane protein 2B
3	9606.ENSP00000303570	0.657	Ankyrin repeat and MYND domain-containing protein 2
4	9606.ENSP00000262067	0.655	Tetraspanin-13
5	9606.ENSP00000412324	0.653	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
6	9606.ENSP00000468424	0.652	Glycylpeptide N-tetradecanoyltransferase 1
7	9606.ENSP00000366280	0.634	VIP36-like protein
8	9606.ENSP00000357594	0.629	Calcium homeostasis modulator protein 6
9	9606.ENSP00000009530	0.596	HLA class II histocompatibility antigen gamma chain
10	9606.ENSP00000215754	0.561	Macrophage migration inhibitory factor
11	9606.ENSP00000260408	0.552	Disintegrin and metalloproteinase domain-containing protein 10
12	9606.ENSP00000383044	0.543	Ubiquitin carboxyl-terminal hydrolase 25
13	9606.ENSP00000261416	0.534	Beta-hexosaminidase subunit beta
14	9606.ENSP00000262461	0.524	Solute carrier family 12 member 2
15	9606.ENSP00000378784	0.521	PHD finger protein 20 like 1
16	9606.ENSP00000461269	0.520	SLP adapter and CSK-interacting membrane protein
17	9606.ENSP00000311453	0.510	High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0042500	1.000	aspartic endopeptidase activity, intramembrane cleaving

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.977	regulation of cellular process
GO:0002682	0.974	regulation of immune system process
GO:0071704	0.970	organic substance metabolic process
GO:0048583	0.963	regulation of response to stimulus
GO:0044238	0.958	primary metabolic process
GO:0033619	0.952	membrane protein proteolysis
GO:0050776	0.870	regulation of immune response
GO:0009966	0.790	regulation of signal transduction
GO:0060759	0.644	regulation of response to cytokine stimulus
GO:0001959	0.634	regulation of cytokine-mediated signaling pathway
GO:0010803	0.366	regulation of tumor necrosis factor-mediated signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0098588	0.998	bounding membrane of organelle
GO:0005886	0.997	plasma membrane
GO:0030659	0.997	cytoplasmic vesicle membrane
GO:0005764	0.995	lysosome
GO:0005765	0.993	lysosomal membrane
GO:0005768	0.987	endosome
GO:0005783	0.985	endoplasmic reticulum
GO:0031984	0.976	organelle subcompartment
GO:0005576	0.956	extracellular region
GO:0005789	0.940	endoplasmic reticulum membrane
GO:0005770	0.896	late endosome
GO:0070062	0.869	extracellular exosome
GO:0098576	0.771	lumenal side of membrane
GO:0098553	0.739	lumenal side of endoplasmic reticulum membrane
GO:0005798	0.717	Golgi-associated vesicle
GO:0030660	0.544	Golgi-associated vesicle membrane
GO:0098562	0.405	cytoplasmic side of membrane
GO:0098554	0.357	cytoplasmic side of endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.23.-	1.000	Aspartic endopeptidases.

[back to server]