StarFunc result for job id Q8TCT9

User Input

>input (377 residues)
MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARG
KNASDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHT
ISPFMNKFFPASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRK
HWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPI
KLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIF
GLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYEESNPKDPAAVTES
KEGTEASASKGLEKKEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D8V0	0.942	0.940	1.186E-51	378	0.960	0.958	Q9D8V0.pdb.gz	HM13_MOUSE Minor histocompatibility antigen H13 OS=Mus musculus OX=10090 GN=Hm13 PE=1 SV=1
2	AFDB:A0A3B3IUB5	0.904	0.814	1.571E-49	420	0.997	0.895	A0A3B3IUB5.pdb.gz	A0A3B3IUB5_HUMAN Histocompatibility minor 13 OS=Homo sapiens OX=9606 GN=HM13 PE=1 SV=1
3	AFDB:Q6IQA7	0.898	0.925	4.172E-45	366	0.756	0.779	Q6IQA7.pdb.gz	Q6IQA7_DANRE Histocompatibility (minor) 13 OS=Danio rerio OX=7955 GN=H13 PE=1 SV=1
4	AFDB:Q9VPQ7	0.843	0.817	5.345E-37	389	0.576	0.558	Q9VPQ7.pdb.gz	Q9VPQ7_DROME SD07518p OS=Drosophila melanogaster OX=7227 GN=Spp PE=1 SV=1
5	AFDB:Q54CN9	0.754	0.801	1.815E-25	354	0.379	0.404	Q54CN9.pdb.gz	Q54CN9_DICDI Peptidase A22B family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292836 PE=3 SV=1
6	AFDB:B9FJ61	0.757	0.829	6.314E-24	343	0.363	0.399	B9FJ61.pdb.gz	SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=SPP2 PE=2 SV=1
7	AFDB:P49049	0.799	0.651	1.741E-23	468	0.393	0.316	P49049.pdb.gz	IMP2_CAEEL Intramembrane protease 2 OS=Caenorhabditis elegans OX=6239 GN=imp-2 PE=1 SV=1
8	AFDB:O81062	0.759	0.828	2.636E-23	344	0.363	0.398	O81062.pdb.gz	SIP_ARATH Signal peptide peptidase OS=Arabidopsis thaliana OX=3702 GN=SPP PE=2 SV=1
9	AFDB:Q8IKQ9	0.775	0.712	7.643E-21	412	0.326	0.299	Q8IKQ9.pdb.gz	Q8IKQ9_PLAF7 Signal peptide peptidase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1457000 PE=3 SV=2
10	AFDB:Q9UTA3	0.687	0.870	9.210E-20	295	0.289	0.369	Q9UTA3.pdb.gz	YL8H_SCHPO Probable intramembrane protease C25B8.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC25B8.17 PE=3 SV=1
11	PDB:6idfB	0.462	0.535	3.510E-4	312	0.125	0.151	6idfB.pdb.gz	Structural basis of Notch recognition by human gamma-secretase
12	PDB:4hygB	0.448	0.642	1.845E-3	247	0.109	0.166	4hygB.pdb.gz
13	PDB:5fn3B	0.426	0.536	4.639E-3	286	0.111	0.147	5fn3B.pdb.gz	Sampling the conformational space of the catalytic subunit of human gamma-secretase.
14	PDB:7y5xB	0.318	0.518	1.538E-2	211	0.103	0.185	7y5xB.pdb.gz	Molecular basis for isoform-selective inhibition of presenilin-1 by MRK-560.
15	PDB:5fn5B	0.252	0.353	5.854E-2	223	0.127	0.215	5fn5B.pdb.gz
16	PDB:7nsgA	0.108	0.099	2.559E-1	430	0.149	0.130	7nsgA.pdb.gz	Structure of human excitatory amino acid transporter 3 (EAAT3) in complex with HIP-B
17	PDB:7vl9R	0.114	0.132	4.057E-1	302	0.095	0.119	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
18	PDB:6nbxF	0.183	0.128	4.879E-1	655	0.085	0.049	6nbxF.pdb.gz	Structure of the complex I-like molecule NDH of oxygenic photosynthesis.
19	PDB:7b93L	0.144	0.105	5.350E-1	607	0.119	0.074	7b93L.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
20	PDB:7nyhL	0.137	0.103	5.350E-1	612	0.106	0.065	7nyhL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5V7	0.0	768	377	1.000	1.000	A0A0S2Z5V7_HUMAN Histocompatibility 13 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=HM13 PE=2 SV=1
2	A0A3B3IUB5	0.0	748	420	1.000	0.898	A0A3B3IUB5_HUMAN Histocompatibility minor 13 OS=Homo sapiens OX=9606 GN=HM13 PE=1 SV=1
3	Q6IQA7	0.0	595	366	0.759	0.781	Q6IQA7_DANRE Histocompatibility (minor) 13 OS=Danio rerio OX=7955 GN=H13 PE=1 SV=1
4	Q8TCT9	0.0	768	377	1.000	1.000	HM13_HUMAN Minor histocompatibility antigen H13 OS=Homo sapiens OX=9606 GN=HM13 PE=1 SV=1
5	Q9D8V0	0.0	722	378	0.950	0.947	HM13_MOUSE Minor histocompatibility antigen H13 OS=Mus musculus OX=10090 GN=Hm13 PE=1 SV=1
6	Q9VPQ7	1.86e-159	454	389	0.568	0.550	Q9VPQ7_DROME SD07518p OS=Drosophila melanogaster OX=7227 GN=Spp PE=1 SV=1
7	Q54CN9	7.82e-86	266	354	0.395	0.421	Q54CN9_DICDI Peptidase A22B family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292836 PE=3 SV=1
8	O81062	2.03e-72	231	344	0.374	0.410	SIP_ARATH Signal peptide peptidase OS=Arabidopsis thaliana OX=3702 GN=SPP PE=2 SV=1
9	B9FJ61	5.04e-70	225	343	0.366	0.402	SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=SPP2 PE=2 SV=1
10	Q6ZGL9	1.23e-69	224	343	0.361	0.397	SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=SPP1 PE=2 SV=1
11	P49049	5.49e-62	207	468	0.271	0.218	IMP2_CAEEL Intramembrane protease 2 OS=Caenorhabditis elegans OX=6239 GN=imp-2 PE=1 SV=1
12	Q8IKQ9	2.97e-60	201	412	0.337	0.308	Q8IKQ9_PLAF7 Signal peptide peptidase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1457000 PE=3 SV=2
13	Q9UTA3	6.52e-51	174	295	0.308	0.393	YL8H_SCHPO Probable intramembrane protease C25B8.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC25B8.17 PE=3 SV=1
14	Q93Z32	5.55e-32	125	372	0.271	0.274	SIPL1_ARATH Signal peptide peptidase-like 1 OS=Arabidopsis thaliana OX=3702 GN=SPPL1 PE=2 SV=1
15	P34248	5.44e-27	114	587	0.196	0.126	YKK0_YEAST Probable intramembrane protease YKL100C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKL100C PE=1 SV=1
16	Q9VBL1	1.35e-25	108	417	0.252	0.228	Q9VBL1_DROME FI17310p1 OS=Drosophila melanogaster OX=7227 GN=SppL PE=2 SV=1
17	Q5BP97	5.38e-25	106	382	0.265	0.262	Q5BP97_DANRE Signal peptide peptidase 3 OS=Danio rerio OX=7955 GN=fb94d08 PE=2 SV=1
18	Q8TCT6	5.74e-25	106	384	0.241	0.237	SPPL3_HUMAN Signal peptide peptidase-like 3 OS=Homo sapiens OX=9606 GN=SPPL3 PE=1 SV=2
19	Q9CUS9	5.74e-25	106	384	0.241	0.237	SPPL3_MOUSE Signal peptide peptidase-like 3 OS=Mus musculus OX=10090 GN=Sppl3 PE=1 SV=3
20	Q86P97	9.45e-25	106	422	0.249	0.223	Q86P97_DROME GM06145p OS=Drosophila melanogaster OX=7227 GN=SppL PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14248 DUF4345	12	17.3	Domain of unknown function (DUF4345)
2	PF04258 Peptidase_A22B	5.9e-99	342.8	Signal peptide peptidase
3	PF01080 Presenilin	53	14.1	Presenilin
4	PF06550 SPP	0.2	22.7	Signal-peptide peptidase, presenilin aspartyl protease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000012161

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000000850	0.965	Signal sequence receptor, beta (translocon-associated protein beta)
2	9601.ENSPPYP00000015913	0.960	Translocon-associated protein subunit gamma
3	9601.ENSPPYP00000023341	0.935	Translocon-associated protein subunit delta
4	9601.ENSPPYP00000021785	0.885	Protein transport protein Sec61 subunit beta
5	9601.ENSPPYP00000015716	0.858	STT3B, subunit of the oligosaccharyltransferase complex (catalytic)
6	9601.ENSPPYP00000024352	0.845	Pongo abelii transmembrane emp24-like trafficking protein 10 (yeast) (TMED10), mRNA
7	9601.ENSPPYP00000002050	0.827	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol- pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme a [...]
8	9601.ENSPPYP00000020934	0.792	Stimulatory or required for the translocation of secretory proteins across the ER membrane
9	9601.ENSPPYP00000004206	0.779	Signal peptidase complex subunit 2
10	9601.ENSPPYP00000014123	0.777	May function as a chaperone that inhibits aggregation of misfolded proteins. Negatively regulates the unfolded protein response (UPR) through binding to UPR sensors such as ERN1, which in turn inactivates ERN1 signaling. May also regulate the UPR via the EIF2AK3 UPR sensor. Plays a role in platelet aggregation and activation by agonists such as convulxin, collagen and thrombin.
11	9601.ENSPPYP00000000739	0.775	Coatomer subunit alpha
12	9601.ENSPPYP00000007540	0.742	Lectin, mannose-binding, 1 like
13	9601.ENSPPYP00000004611	0.738	STT3A, subunit of the oligosaccharyltransferase complex (catalytic)
14	9601.ENSPPYP00000012266	0.727	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol- pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme a [...]
15	9601.ENSPPYP00000002424	0.705	Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins (By similarity)
16	9601.ENSPPYP00000015030	0.705	Protein transport protein Sec61 subunit alpha isoform 1
17	9601.ENSPPYP00000015479	0.696	Mesencephalic astrocyte-derived neurotrophic factor
18	9601.ENSPPYP00000020590	0.690	Tumor suppressor candidate 3
19	9601.ENSPPYP00000022939	0.690	Acts as accessory component of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Involved in N-glycosylation of STT3B-dependent substrates. Specifically required for the glycosylation of a subset of acceptor sites that are near cysteine residues
20	9601.ENSPPYP00000015835	0.678	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042500	1.000	aspartic endopeptidase activity, intramembrane cleaving
GO:0005515	0.999	protein binding
GO:0031625	0.992	ubiquitin protein ligase binding
GO:0046983	0.986	protein dimerization activity
GO:0042802	0.984	identical protein binding
GO:0042803	0.889	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006810	0.902	transport
GO:0009987	0.617	cellular process
GO:0050896	0.560	response to stimulus
GO:0071704	0.559	organic substance metabolic process
GO:0065007	0.557	biological regulation
GO:0044238	0.531	primary metabolic process
GO:0006508	0.468	proteolysis
GO:0032501	0.391	multicellular organismal process
GO:0048193	0.387	Golgi vesicle transport
GO:0032502	0.385	developmental process
GO:0048856	0.383	anatomical structure development
GO:0051716	0.354	cellular response to stimulus
GO:0006950	0.344	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.998	endoplasmic reticulum
GO:0031090	0.982	organelle membrane
GO:0032991	0.951	protein-containing complex
GO:0098588	0.907	bounding membrane of organelle
GO:0031410	0.905	cytoplasmic vesicle
GO:0030659	0.884	cytoplasmic vesicle membrane
GO:0098796	0.882	membrane protein complex
GO:0005798	0.874	Golgi-associated vesicle
GO:0005789	0.828	endoplasmic reticulum membrane
GO:0030660	0.803	Golgi-associated vesicle membrane
GO:0140534	0.381	endoplasmic reticulum protein-containing complex
GO:0005791	0.361	rough endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.23.-	1.000	Aspartic endopeptidases.

[back to server]