StarFunc result for job id Q8TCU5

User Input

>input (1115 residues)
MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APRAASRAPDDSRAGAQRDEPEPGTRRSPAPSPGARWLGSTLHGRGPPGSRKPGEGARAE
ALWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSLVLHIPVISIVRHEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITAN
LPSTQDLLSFLQIQLESIKNSTPTVVMFGCDMESIRRIFEITTQFGVMPPELRWVLGDSQ
NVEELRTEGLPLGLIAHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCM
EVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIVSSENNFFIWNLQHDPMGKPMWTR
LGSWQGGKIVMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLDPMTNDSSTLDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSAL
NICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLD
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFM
DMLHDKWYRVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLL
PRIKNKSKLQYWLHTSQRLHRAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLS
HDNRRKYIFSDEEGQNQLGIRIHQDIPLPPRRRELPALRTTNGKADSLNVSRNSVMQELS
ELEKQIQVIRQELQLAVSRKTELEEYQRTSRTCES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AIR5	0.404	0.398	0.000	1135	0.934	0.917	A2AIR5.pdb.gz	NMD3A_MOUSE Glutamate receptor ionotropic, NMDA 3A OS=Mus musculus OX=10090 GN=Grin3a PE=1 SV=1
2	AFDB:Q8TCU5	1.000	1.000	0.000	1115	1.000	1.000	Q8TCU5.pdb.gz	NMD3A_HUMAN Glutamate receptor ionotropic, NMDA 3A OS=Homo sapiens OX=9606 GN=GRIN3A PE=1 SV=2
3	AFDB:Q9W581	0.379	0.390	3.159E-61	1083	0.239	0.247	Q9W581.pdb.gz	Q9W581_DROME NMDA receptor 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=2
4	AFDB:B7ZSK1	0.353	0.279	9.888E-61	1451	0.204	0.156	B7ZSK1.pdb.gz	NMDE1_XENLA Glutamate receptor ionotropic, NMDA 2A OS=Xenopus laevis OX=8355 GN=grin2a PE=1 SV=1
5	AFDB:P35436	0.357	0.278	5.328E-60	1464	0.217	0.165	P35436.pdb.gz	NMDE1_MOUSE Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus OX=10090 GN=Grin2a PE=1 SV=2
6	AFDB:Q24418	0.348	0.386	5.328E-60	997	0.210	0.235	Q24418.pdb.gz	NMDA1_DROME Glutamate [NMDA] receptor subunit 1 OS=Drosophila melanogaster OX=7227 GN=Nmdar1 PE=1 SV=1
7	AFDB:O76903	0.475	0.516	1.036E-57	1012	0.213	0.234	O76903.pdb.gz	O76903_DROME EG:80H7.7 protein OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1
8	AFDB:Q14957	0.351	0.320	2.471E-57	1233	0.220	0.199	Q14957.pdb.gz	NMDE3_HUMAN Glutamate receptor ionotropic, NMDA 2C OS=Homo sapiens OX=9606 GN=GRIN2C PE=1 SV=3
9	AFDB:Q01098	0.369	0.335	4.029E-57	1239	0.222	0.200	Q01098.pdb.gz	NMDE3_MOUSE Glutamate receptor ionotropic, NMDA 2C OS=Mus musculus OX=10090 GN=Grin2c PE=1 SV=2
10	AFDB:O15399	0.363	0.307	3.008E-56	1336	0.216	0.180	O15399.pdb.gz	NMDE4_HUMAN Glutamate receptor ionotropic, NMDA 2D OS=Homo sapiens OX=9606 GN=GRIN2D PE=1 SV=2
11	PDB:4tllA	0.274	0.383	2.988E-46	767	0.175	0.254	4tllA.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
12	PDB:4pe5C	0.277	0.394	2.772E-45	754	0.174	0.257	4pe5C.pdb.gz	Crystal structure of a heterotetrameric NMDA receptor ion channel.
13	PDB:7rz4A	0.241	0.266	2.436E-44	993	0.154	0.173	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
14	PDB:4tlmC	0.269	0.384	3.490E-43	750	0.176	0.261	4tlmC.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
15	PDB:7rzaA	0.237	0.266	1.259E-41	981	0.157	0.178	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
16	PDB:7ocaA	0.233	0.315	1.842E-41	775	0.157	0.226	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
17	PDB:5weoA	0.251	0.279	3.535E-41	988	0.156	0.176	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
18	PDB:5kbtA	0.236	0.265	3.463E-40	973	0.152	0.175	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
19	PDB:5idfB	0.242	0.341	8.721E-40	734	0.151	0.229	5idfB.pdb.gz
20	PDB:4u1xC	0.239	0.342	5.840E-39	755	0.147	0.217	4u1xC.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AIR5	0.0	2128	1135	0.934	0.917	NMD3A_MOUSE Glutamate receptor ionotropic, NMDA 3A OS=Mus musculus OX=10090 GN=Grin3a PE=1 SV=1
2	O60391	0.0	971	1043	0.441	0.472	NMD3B_HUMAN Glutamate receptor ionotropic, NMDA 3B OS=Homo sapiens OX=9606 GN=GRIN3B PE=2 SV=2
3	Q8TCU5	0.0	2315	1115	1.000	1.000	NMD3A_HUMAN Glutamate receptor ionotropic, NMDA 3A OS=Homo sapiens OX=9606 GN=GRIN3A PE=1 SV=2
4	Q8VHN2	0.0	979	1002	0.431	0.480	NMD3B_RAT Glutamate receptor ionotropic, NMDA 3B OS=Rattus norvegicus OX=10116 GN=Grin3b PE=1 SV=2
5	Q91ZU9	0.0	970	1003	0.433	0.482	NMD3B_MOUSE Glutamate receptor ionotropic, NMDA 3B OS=Mus musculus OX=10090 GN=Grin3b PE=1 SV=1
6	Q9R1M7	0.0	2119	1135	0.926	0.910	NMD3A_RAT Glutamate receptor ionotropic, NMDA 3A OS=Rattus norvegicus OX=10116 GN=Grin3a PE=1 SV=1
7	A7XY94	4.32e-90	320	1448	0.211	0.162	NMDE2_XENLA Glutamate receptor ionotropic, NMDA 2B OS=Xenopus laevis OX=8355 GN=grin2b PE=1 SV=1
8	Q01097	2.34e-88	315	1482	0.231	0.174	NMDE2_MOUSE Glutamate receptor ionotropic, NMDA 2B OS=Mus musculus OX=10090 GN=Grin2b PE=1 SV=3
9	Q00959	2.76e-88	314	1464	0.222	0.169	NMDE1_RAT Glutamate receptor ionotropic, NMDA 2A OS=Rattus norvegicus OX=10116 GN=Grin2a PE=1 SV=2
10	Q00960	3.94e-88	314	1482	0.227	0.171	NMDE2_RAT Glutamate receptor ionotropic, NMDA 2B OS=Rattus norvegicus OX=10116 GN=Grin2b PE=1 SV=1
11	P35436	6.65e-88	313	1464	0.221	0.168	NMDE1_MOUSE Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus OX=10090 GN=Grin2a PE=1 SV=2
12	Q13224	9.93e-88	313	1484	0.226	0.170	NMDE2_HUMAN Glutamate receptor ionotropic, NMDA 2B OS=Homo sapiens OX=9606 GN=GRIN2B PE=1 SV=3
13	Q12879	1.53e-85	306	1464	0.205	0.156	NMDE1_HUMAN Glutamate receptor ionotropic, NMDA 2A OS=Homo sapiens OX=9606 GN=GRIN2A PE=1 SV=1
14	Q9W581	1.49e-80	288	1083	0.207	0.213	Q9W581_DROME NMDA receptor 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=2
15	X2JDW0	1.92e-80	288	1082	0.207	0.213	X2JDW0_DROME NMDA receptor 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1
16	Q6IWN7	2.23e-80	287	1070	0.207	0.216	Q6IWN7_DROME NMDA receptor 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=1
17	B7ZSK1	3.51e-80	290	1451	0.199	0.153	NMDE1_XENLA Glutamate receptor ionotropic, NMDA 2A OS=Xenopus laevis OX=8355 GN=grin2a PE=1 SV=1
18	E1JJC6	6.88e-80	284	941	0.206	0.244	E1JJC6_DROME NMDA receptor 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1
19	Q8MM14	1.64e-79	282	902	0.194	0.239	Q8MM14_DROME Glutamate NMDA receptor subunit variant NR2-a OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=1
20	Q01098	4.17e-79	285	1239	0.210	0.189	NMDE3_MOUSE Glutamate receptor ionotropic, NMDA 2C OS=Mus musculus OX=10090 GN=Grin2c PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	5.9e-05	34.0	Receptor family ligand binding region
2	PF17522 DUF5446	2.1e+02	13.5	Family of unknown function (DUF5446)
3	PF00060 Lig_chan	8e-25	98.9	Ligand-gated ion channel
4	PF10613 Lig_chan-Glu_bd	1.7e-23	94.3	Ligated ion channel L-glutamate- and glycine-binding site
5	PF00497 SBP_bac_3	1.4e-17	75.4	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355155

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.981	Disks large homolog 4
2	9606.ENSP00000360608	0.967	Glutamate receptor ionotropic, NMDA 1
3	9606.ENSP00000484060	0.949	Protein kinase C and casein kinase substrate in neurons protein 1
4	9606.ENSP00000379818	0.946	Glutamate receptor ionotropic, NMDA 2A
5	9606.ENSP00000477455	0.944	Glutamate receptor ionotropic, NMDA 2B
6	9606.ENSP00000263269	0.935	Glutamate receptor ionotropic, NMDA 2D
7	9606.ENSP00000293190	0.935	Glutamate receptor ionotropic, NMDA 2C
8	9606.ENSP00000440185	0.847	Proenkephalin-B
9	9606.ENSP00000300105	0.825	Voltage-dependent calcium channel gamma-2 subunit
10	9606.ENSP00000428994	0.822	Glutamate receptor 1
11	9606.ENSP00000282499	0.814	Glutamate receptor 4
12	9606.ENSP00000296526	0.812	Glutamate receptor 2
13	9606.ENSP00000481554	0.807	Glutamate receptor 3
14	9606.ENSP00000005284	0.802	Voltage-dependent calcium channel gamma-3 subunit
15	9606.ENSP00000310003	0.789	Protein cornichon homolog 2
16	9606.ENSP00000272133	0.782	Protein cornichon homolog 3
17	9606.ENSP00000262138	0.780	Voltage-dependent calcium channel gamma-4 subunit
18	9606.ENSP00000375647	0.779	Voltage-dependent calcium channel gamma-7 subunit
19	9606.ENSP00000436836	0.779	Voltage-dependent calcium channel gamma-5 subunit
20	9606.ENSP00000270458	0.774	Voltage-dependent calcium channel gamma-8 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004972	1.000	NMDA glutamate receptor activity
GO:0043167	0.946	ion binding
GO:0008324	0.942	monoatomic cation transmembrane transporter activity
GO:0031406	0.906	carboxylic acid binding
GO:0016597	0.903	amino acid binding
GO:0005261	0.893	monoatomic cation channel activity
GO:0043169	0.889	cation binding
GO:0016594	0.884	glycine binding
GO:0042802	0.782	identical protein binding
GO:1901702	0.639	salt transmembrane transporter activity
GO:0046873	0.607	metal ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0009987	0.992	cellular process
GO:0050789	0.991	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0023052	0.940	signaling
GO:0007154	0.938	cell communication
GO:0051179	0.925	localization
GO:0051234	0.922	establishment of localization
GO:0007165	0.913	signal transduction
GO:0006811	0.891	monoatomic ion transport
GO:0032501	0.865	multicellular organismal process
GO:0007166	0.809	cell surface receptor signaling pathway
GO:0006816	0.806	calcium ion transport
GO:0042221	0.772	response to chemical
GO:0010033	0.658	response to organic substance
GO:1901700	0.630	response to oxygen-containing compound
GO:0007215	0.482	glutamate receptor signaling pathway
GO:0032502	0.446	developmental process
GO:0048518	0.423	positive regulation of biological process
GO:0045471	0.411	response to ethanol
GO:0048522	0.351	positive regulation of cellular process
GO:0071840	0.346	cellular component organization or biogenesis
GO:0010646	0.331	regulation of cell communication
GO:0023051	0.325	regulation of signaling
GO:0048519	0.324	negative regulation of biological process
GO:0048856	0.308	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0045202	0.998	synapse
GO:0098796	0.996	membrane protein complex
GO:0005783	0.995	endoplasmic reticulum
GO:0031090	0.994	organelle membrane
GO:0034702	0.992	ion channel complex
GO:0098797	0.988	plasma membrane protein complex
GO:0008328	0.975	ionotropic glutamate receptor complex
GO:0031984	0.962	organelle subcompartment
GO:0042175	0.961	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.951	endoplasmic reticulum membrane
GO:0017146	0.931	NMDA selective glutamate receptor complex
GO:0098590	0.806	plasma membrane region
GO:0098794	0.802	postsynapse
GO:0036477	0.742	somatodendritic compartment
GO:0097060	0.740	synaptic membrane
GO:0045211	0.716	postsynaptic membrane
GO:0098978	0.670	glutamatergic synapse
GO:0042995	0.522	cell projection
GO:0043005	0.478	neuron projection
GO:0043025	0.415	neuronal cell body
GO:0099572	0.317	postsynaptic specialization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]