StarFunc result for job id Q8TCU6

User Input

>input (1659 residues)
MEAPSGSEPGGDGAGDCAHPDPRAPGAAAPSSGPGPCAAARESERQLRLRLCVLNEILGT
ERDYVGTLRFLQSAFLHRIRQNVADSVEKGLTEENVKVLFSNIEDILEVHKDFLAALEYC
LHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGG
RKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINET
KRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVY
CKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWK
IHNTAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMM
MNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVS
DKHQFKNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYK
SVLPGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEE
MEGTSSKNKQLRNDFKLVENILAKRLLILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEVA
GLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLC
FQIRGAAPPYVYAVGRGSEAMAAGLCAGQCILKVNGSNVMNDGAPEVLEHFQAFRSRREE
ALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQEEDQADSAFPLLSLGPRLSLCEDSP
MVTLTVDNVHLEHGVVYEYVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAANDSVFVEN
CRRLMALSSAIVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPH
PLCGLDFCPTNCHINLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQH
CITTMAAPSWKCLPAAEGDPQGQGLHDGSFGPASGTLGQEDRGLSFLLKQEDREIQDAYL
QLFTKLDVALKEMKQYVTQINRLLSTITEPTSGGSCDASLAEEASSLPLVSEESEMDRSD
HGGIKKVCFKVAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGS
GDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEF
KQKEECTIRGRSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQ
LRRDAIFCQALVAAVCTFSKQLLAALGYRYNNNGEYEESSRDASRKWLEQVAATGVLLHC
QSLLSPATVKEERTMLEDIWVTLSELDNVTFSFKQLDENYVANTNVFYHIEGSRQALKVI
FYLDSYHFSKLPSRLEGGASLRLHTALFTKVLENVEGLPSPGSQAAEDLQQDINAQSLEK
VQQYYRKLRAFYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHPKPGAAGSV
GAGLIPISSELCYRLGACQMVMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIM
RKQGPRVEILAKNLRVKDQMPQGAPRLYRLCQPPVDGDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R6J2	0.877	0.897	0.000	1622	0.665	0.681	F1R6J2.pdb.gz	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
2	AFDB:Q70Z35	0.769	0.793	0.000	1606	0.565	0.583	Q70Z35.pdb.gz	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
3	AFDB:Q8TCU6	1.000	1.000	0.000	1659	1.000	1.000	Q8TCU6.pdb.gz	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
4	PDB:6pcvA	0.452	0.994	3.758E-97	754	0.453	0.997	6pcvA.pdb.gz
5	PDB:7rx9A	0.130	0.443	6.660E-52	432	0.260	1.000	7rx9A.pdb.gz
6	AFDB:Q9NR80	0.168	0.352	8.951E-24	690	0.079	0.190	Q9NR80.pdb.gz	ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=ARHGEF4 PE=1 SV=3
7	AFDB:A0A2R8QCF3	0.167	0.415	2.248E-23	550	0.076	0.229	A0A2R8QCF3.pdb.gz
8	AFDB:A0A0A6YYF8	0.160	0.391	3.715E-23	564	0.076	0.223	A0A0A6YYF8.pdb.gz	A0A0A6YYF8_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
9	PDB:4mt6A	0.157	0.510	9.223E-22	389	0.072	0.306	4mt6A.pdb.gz
10	AFDB:Q8N4T4	0.170	0.678	6.659E-15	335	0.047	0.233	Q8N4T4.pdb.gz	ARG39_HUMAN Rho guanine nucleotide exchange factor 39 OS=Homo sapiens OX=9606 GN=ARHGEF39 PE=1 SV=1
11	AFDB:Q8TB45	0.076	0.249	2.650E-14	409	0.068	0.274	Q8TB45.pdb.gz	DPTOR_HUMAN DEP domain-containing mTOR-interacting protein OS=Homo sapiens OX=9606 GN=DEPTOR PE=1 SV=2
12	AFDB:O88842	0.117	0.236	5.871E-14	733	0.058	0.132	O88842.pdb.gz	FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fgd3 PE=1 SV=1
13	AFDB:Q9VS45	0.173	0.412	8.557E-14	647	0.043	0.111	Q9VS45.pdb.gz	Q9VS45_DROME LD03170p OS=Drosophila melanogaster OX=7227 GN=RhoGEF4 PE=2 SV=1
14	PDB:7pe9I	0.073	0.301	1.797E-13	317	0.054	0.284	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
15	PDB:4gouA	0.101	0.304	2.965E-7	507	0.029	0.095	4gouA.pdb.gz
16	PDB:6u3eA	0.064	0.204	1.792E-4	397	0.041	0.171	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
17	PDB:2xkxA	0.047	0.103	3.971E-4	721	0.020	0.046	2xkxA.pdb.gz
18	PDB:6bbpA	0.067	0.160	7.135E-4	520	0.030	0.096	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
19	PDB:4f7zA	0.066	0.103	2.209E-3	946	0.027	0.048	4f7zA.pdb.gz
20	PDB:2byvE	0.063	0.102	3.088E-3	922	0.028	0.050	2byvE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GLR6	0.0	3042	1646	0.896	0.903	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
2	D3ZS72	0.0	2979	1635	0.882	0.895	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
3	F1R6J2	0.0	2281	1622	0.666	0.681	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
4	Q3LAC4	0.0	1843	1598	0.558	0.579	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2
5	Q69ZK0	0.0	3060	1650	0.898	0.903	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
6	Q70Z35	0.0	1882	1606	0.566	0.585	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
7	Q8TCU6	0.0	3455	1659	1.000	1.000	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
8	Q9NR80	1.83e-61	227	690	0.086	0.207	ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=ARHGEF4 PE=1 SV=3
9	A0A1B0GVC4	8.63e-57	206	454	0.074	0.271	A0A1B0GVC4_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
10	F1Q628	1.00e-56	208	514	0.078	0.251	F1Q628_DANRE Rho guanine nucleotide exchange factor 9 OS=Danio rerio OX=7955 GN=arhgef9 PE=4 SV=1
11	B1AMR3	2.48e-56	206	495	0.074	0.248	B1AMR3_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
12	A0A5F9ZGZ3	2.51e-56	206	489	0.074	0.252	A0A5F9ZGZ3_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
13	A0A1B0GV84	2.53e-56	207	506	0.074	0.243	A0A1B0GV84_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
14	Q9QX73	2.70e-56	206	493	0.074	0.249	ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus OX=10116 GN=Arhgef9 PE=1 SV=1
15	A0A1B0GWI5	2.78e-56	207	529	0.074	0.233	A0A1B0GWI5_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
16	Q3UTH8	3.45e-56	206	516	0.074	0.238	ARHG9_MOUSE Rho guanine nucleotide exchange factor 9 OS=Mus musculus OX=10090 GN=Arhgef9 PE=1 SV=1
17	O43307	3.61e-56	206	516	0.074	0.238	ARHG9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=3
18	A0A5F9ZHY9	4.25e-56	206	523	0.074	0.235	A0A5F9ZHY9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
19	A0A0A6YYF8	9.98e-56	206	564	0.074	0.218	A0A0A6YYF8_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
20	A0A024RDM6	8.48e-55	206	652	0.078	0.199	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	1.3e-39	145.3	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF00595 PDZ	6.7e-05	34.5	PDZ domain
3	PF17820 PDZ_6	1.9e-08	45.4	PDZ domain
4	PF02163 Peptidase_M50	0.86	20.4	Peptidase family M50
5	PF00169 PH	0.14	24.1	PH domain
6	PF15411 PH_10	0.76	21.4	Pleckstrin homology domain
7	PF00621 RhoGEF	4.5e-44	162.4	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361009

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348461	0.994	Ras-related C3 botulinum toxin substrate 1
2	9606.ENSP00000383118	0.981	Cell division control protein 42 homolog
3	9606.ENSP00000481878	0.958	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
4	9606.ENSP00000249071	0.957	Ras-related C3 botulinum toxin substrate 2
5	9606.ENSP00000334448	0.942	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
6	9606.ENSP00000304283	0.926	Ras-related C3 botulinum toxin substrate 3
7	9606.ENSP00000289153	0.858	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
8	9606.ENSP00000263967	0.851	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
9	9606.ENSP00000366563	0.848	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
10	9606.ENSP00000428056	0.842	Phosphatidylinositol 3-kinase regulatory subunit alpha
11	9606.ENSP00000354558	0.836	Serine/threonine-protein kinase mTOR
12	9606.ENSP00000262741	0.818	Phosphatidylinositol 3-kinase regulatory subunit gamma
13	9606.ENSP00000222254	0.817	Phosphatidylinositol 3-kinase regulatory subunit beta
14	9606.ENSP00000232564	0.770	Guanine nucleotide-binding protein subunit beta-4
15	9606.ENSP00000305260	0.741	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
16	9606.ENSP00000296782	0.740	Rapamycin-insensitive companion of mTOR
17	9606.ENSP00000229264	0.735	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
18	9606.ENSP00000261837	0.729	Guanine nucleotide-binding protein subunit beta-5
19	9606.ENSP00000263991	0.720	EH domain-binding protein 1
20	9606.ENSP00000451828	0.688	RAC-alpha serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0008289	0.987	lipid binding
GO:0019899	0.979	enzyme binding
GO:0005543	0.937	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.967	response to stimulus
GO:0007154	0.966	cell communication
GO:0040017	0.906	positive regulation of locomotion
GO:0032956	0.905	regulation of actin cytoskeleton organization
GO:0048522	0.903	positive regulation of cellular process
GO:0051716	0.899	cellular response to stimulus
GO:0071840	0.898	cellular component organization or biogenesis
GO:0016043	0.886	cellular component organization
GO:0051056	0.873	regulation of small GTPase mediated signal transduction
GO:0110053	0.867	regulation of actin filament organization
GO:0044087	0.853	regulation of cellular component biogenesis
GO:0043254	0.835	regulation of protein-containing complex assembly
GO:0007165	0.828	signal transduction
GO:2000145	0.826	regulation of cell motility
GO:0032501	0.820	multicellular organismal process
GO:0008064	0.795	regulation of actin polymerization or depolymerization
GO:0032271	0.794	regulation of protein polymerization
GO:0030833	0.721	regulation of actin filament polymerization
GO:0050793	0.668	regulation of developmental process
GO:0002376	0.544	immune system process
GO:0031344	0.540	regulation of cell projection organization
GO:0120035	0.534	regulation of plasma membrane bounded cell projection organization
GO:2000147	0.412	positive regulation of cell motility
GO:0035556	0.411	intracellular signal transduction
GO:0044237	0.390	cellular metabolic process
GO:0001775	0.387	cell activation
GO:0007010	0.351	cytoskeleton organization
GO:0032502	0.335	developmental process
GO:0048856	0.323	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.997	cytosol
GO:0043226	0.781	organelle
GO:0043229	0.703	intracellular organelle
GO:0043231	0.667	intracellular membrane-bounded organelle
GO:0043005	0.523	neuron projection
GO:0036477	0.356	somatodendritic compartment
GO:0030427	0.318	site of polarized growth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]