StarFunc result for job id Q8TCX1

User Input

>input (351 residues)
MPSETLWEIAKAEVEKRGINGSEGDGAEIAEKFVFFIGSKNGGKTTIILRCLDRDEPPKP
TLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPITGDTLRTFSLVLVLDLSKP
NDLWPTMENLLQATKSHVDKVIMKLGKTNAKAVSEMRQKIWNNMPKDHPDHELIDPFPVP
LVIIGSKYDVFQDFESEKRKVICKTLRFVAHYYGASLMFTSKSEALLLKIRGVINQLAFG
IDKSKSICVDQNKPLFITAGLDSFGQIGSPPVPENDIGKLHAHSPMELWKKVYEKLFPPK
SINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIELDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TCX1	1.000	1.000	7.862E-69	351	1.000	1.000	Q8TCX1.pdb.gz	DC2L1_HUMAN Cytoplasmic dynein 2 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC2LI1 PE=1 SV=1
2	AFDB:Q6AY43	0.945	0.945	4.935E-61	351	0.883	0.883	Q6AY43.pdb.gz	DC2L1_RAT Cytoplasmic dynein 2 light intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync2li1 PE=1 SV=2
3	AFDB:Q7SXY4	0.881	0.865	4.376E-45	358	0.601	0.589	Q7SXY4.pdb.gz	DC2L1_DANRE Cytoplasmic dynein 2 light intermediate chain 1 OS=Danio rerio OX=7955 GN=dync2li1 PE=2 SV=1
4	PDB:6rlbE	0.678	0.756	2.059E-39	312	0.880	0.990	6rlbE.pdb.gz
5	AFDB:Q19119	0.818	0.779	4.053E-30	370	0.330	0.314	Q19119.pdb.gz	Q19119_CAEEL Cytoplasmic dynein 2 light intermediate chain 1 OS=Caenorhabditis elegans OX=6239 GN=xbx-1 PE=3 SV=2
6	AFDB:Q381A5	0.713	0.604	3.118E-24	418	0.274	0.230	Q381A5.pdb.gz	Q381A5_TRYB2 Cytoplasmic dynein 2 light intermediate chain 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8570 PE=3 SV=1
7	AFDB:Q7XA07	0.717	0.597	2.508E-23	427	0.293	0.241	Q7XA07.pdb.gz	DC2L1_CHLRE Cytoplasmic dynein 2 light intermediate chain 1 OS=Chlamydomonas reinhardtii OX=3055 GN=D1BLIC PE=1 SV=1
8	AFDB:F1RB89	0.603	0.437	7.747E-17	500	0.197	0.138	F1RB89.pdb.gz	F1RB89_DANRE Dynein light intermediate chain OS=Danio rerio OX=7955 GN=fc08b04 PE=1 SV=1
9	AFDB:Q62698	0.612	0.446	7.415E-16	497	0.199	0.141	Q62698.pdb.gz	DC1L2_RAT Cytoplasmic dynein 1 light intermediate chain 2 OS=Rattus norvegicus OX=10116 GN=Dync1li2 PE=1 SV=1
10	AFDB:Q9QXU8	0.595	0.410	9.349E-16	523	0.217	0.145	Q9QXU8.pdb.gz	DC1L1_RAT Cytoplasmic dynein 1 light intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync1li1 PE=1 SV=1
11	AFDB:Q1LUM9	0.567	0.417	2.502E-15	501	0.185	0.130	Q1LUM9.pdb.gz	Q1LUM9_DANRE Dynein light intermediate chain OS=Danio rerio OX=7955 GN=dncli2 PE=1 SV=1
12	PDB:7z8fj	0.633	0.670	2.579E-15	330	0.185	0.197	7z8fj.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
13	PDB:2f9mA	0.289	0.511	1.954E-6	182	0.103	0.198	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
14	PDB:5szjA	0.368	0.691	2.070E-6	175	0.091	0.183	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
15	PDB:2zetA	0.358	0.656	2.765E-6	181	0.103	0.199	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
16	PDB:4arzA	0.374	0.444	3.290E-6	291	0.085	0.103	4arzA.pdb.gz	Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
17	PDB:6vijB	0.326	0.548	3.290E-6	191	0.100	0.183	6vijB.pdb.gz	Genetic and structural studies of RABL3 reveal an essential role in lymphoid development and function.
18	PDB:4cz2B	0.312	0.554	3.694E-6	179	0.105	0.207	4cz2B.pdb.gz	Varp is Recruited on to Endosomes by Direct Interaction with Retromer, Where Together They Function in Export to the Cell Surface.
19	PDB:6zqtA	0.322	0.600	4.395E-6	173	0.097	0.197	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
20	PDB:1zbdA	0.329	0.609	6.593E-6	177	0.077	0.153	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6AY43	0.0	646	351	0.883	0.883	DC2L1_RAT Cytoplasmic dynein 2 light intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync2li1 PE=1 SV=2
2	Q8K0T2	0.0	640	351	0.877	0.877	DC2L1_MOUSE Cytoplasmic dynein 2 light intermediate chain 1 OS=Mus musculus OX=10090 GN=Dync2li1 PE=1 SV=1
3	Q8TCX1	0.0	723	351	1.000	1.000	DC2L1_HUMAN Cytoplasmic dynein 2 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC2LI1 PE=1 SV=1
4	Q7SXY4	1.13e-144	415	358	0.598	0.587	DC2L1_DANRE Cytoplasmic dynein 2 light intermediate chain 1 OS=Danio rerio OX=7955 GN=dync2li1 PE=2 SV=1
5	Q19119	6.41e-64	209	370	0.330	0.314	Q19119_CAEEL Cytoplasmic dynein 2 light intermediate chain 1 OS=Caenorhabditis elegans OX=6239 GN=xbx-1 PE=3 SV=2
6	Q7XA07	8.76e-37	139	427	0.291	0.239	DC2L1_CHLRE Cytoplasmic dynein 2 light intermediate chain 1 OS=Chlamydomonas reinhardtii OX=3055 GN=D1BLIC PE=1 SV=1
7	Q381A5	5.10e-34	131	418	0.268	0.225	Q381A5_TRYB2 Cytoplasmic dynein 2 light intermediate chain 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8570 PE=3 SV=1
8	Q9Y6G9	5.76e-07	53.5	523	0.182	0.122	DC1L1_HUMAN Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3
9	Q9QXU8	1.28e-06	52.4	523	0.182	0.122	DC1L1_RAT Cytoplasmic dynein 1 light intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync1li1 PE=1 SV=1
10	Q62698	6.19e-06	50.1	497	0.182	0.129	DC1L2_RAT Cytoplasmic dynein 1 light intermediate chain 2 OS=Rattus norvegicus OX=10116 GN=Dync1li2 PE=1 SV=1
11	Q6PDL0	1.02e-05	49.7	492	0.182	0.130	DC1L2_MOUSE Cytoplasmic dynein 1 light intermediate chain 2 OS=Mus musculus OX=10090 GN=Dync1li2 PE=1 SV=2
12	O43237	1.24e-05	49.3	492	0.179	0.128	DC1L2_HUMAN Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2 PE=1 SV=1
13	F1RB89	7.64e-05	46.6	500	0.182	0.128	F1RB89_DANRE Dynein light intermediate chain OS=Danio rerio OX=7955 GN=fc08b04 PE=1 SV=1
14	G5ECK7	0.006	40.4	441	0.157	0.125	G5ECK7_CAEEL Dynein light intermediate chain OS=Caenorhabditis elegans OX=6239 GN=dli-1 PE=1 SV=1
15	A0A0R4ICI6	0.041	38.1	491	0.174	0.124	A0A0R4ICI6_DANRE Dynein light intermediate chain OS=Danio rerio OX=7955 GN=dncli2 PE=1 SV=1
16	Q1LUM9	0.045	38.1	501	0.174	0.122	Q1LUM9_DANRE Dynein light intermediate chain OS=Danio rerio OX=7955 GN=dncli2 PE=1 SV=1
17	G5ED34	0.14	36.6	443	0.157	0.124	G5ED34_CAEEL Dynein light intermediate chain OS=Caenorhabditis elegans OX=6239 GN=dli-1 PE=1 SV=1
18	Q9VZ20	0.19	36.2	493	0.179	0.128	Q9VZ20_DROME Dynein light intermediate chain OS=Drosophila melanogaster OX=7227 GN=Dlic PE=1 SV=2
19	P38987	0.37	34.7	245	0.100	0.143	TEM1_YEAST Protein TEM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TEM1 PE=1 SV=1
20	P87027	0.37	34.3	198	0.063	0.111	SPG1_SCHPO Septum-promoting GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spg1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05783 DLIC	5.9e-05	33.7	Dynein light intermediate chain (DLIC)
2	PF08477 Roc	1.7e+02	13.9	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000474032

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381167	0.999	Cytoplasmic dynein 2 heavy chain 1
2	9606.ENSP00000384290	0.998	WD repeat-containing protein 60
3	9606.ENSP00000361800	0.993	WD repeat-containing protein 34
4	9606.ENSP00000349679	0.987	Dynein light chain roadblock-type 1
5	9606.ENSP00000376297	0.987	Dynein light chain 1, cytoplasmic
6	9606.ENSP00000258198	0.953	Cytoplasmic dynein 1 light intermediate chain 2
7	9606.ENSP00000324323	0.949	Tctex1 domain-containing protein 2
8	9606.ENSP00000367841	0.946	Dynein light chain Tctex-type 3
9	9606.ENSP00000406012	0.946	Intraflagellar transport protein 140 homolog
10	9606.ENSP00000382717	0.942	WD repeat-containing protein 19
11	9606.ENSP00000264538	0.935	Intraflagellar transport protein 57 homolog
12	9606.ENSP00000348965	0.935	Cytoplasmic dynein 1 heavy chain 1
13	9606.ENSP00000380308	0.934	Cytoplasmic dynein 1 intermediate chain 2
14	9606.ENSP00000320130	0.933	Cytoplasmic dynein 1 intermediate chain 1
15	9606.ENSP00000323580	0.931	Intraflagellar transport protein 88 homolog
16	9606.ENSP00000356056	0.929	Dynein light chain Tctex-type 1
17	9606.ENSP00000477310	0.928	Dynein light chain 2, cytoplasmic
18	9606.ENSP00000302936	0.926	Dynein light chain roadblock-type 2
19	9606.ENSP00000314444	0.922	WD repeat-containing protein 35
20	9606.ENSP00000312778	0.921	Intraflagellar transport protein 80 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045504	0.997	dynein heavy chain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060271	0.997	cilium assembly
GO:0051179	0.974	localization
GO:0065007	0.965	biological regulation
GO:0050794	0.961	regulation of cellular process
GO:0051641	0.958	cellular localization
GO:0007018	0.958	microtubule-based movement
GO:0010970	0.951	transport along microtubule
GO:0051128	0.947	regulation of cellular component organization
GO:0042073	0.913	intraciliary transport
GO:0033043	0.829	regulation of organelle organization
GO:0044087	0.791	regulation of cellular component biogenesis
GO:1902115	0.767	regulation of organelle assembly
GO:0031344	0.512	regulation of cell projection organization
GO:0120032	0.479	regulation of plasma membrane bounded cell projection assembly
GO:1902017	0.336	regulation of cilium assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005929	1.000	cilium
GO:0015630	0.995	microtubule cytoskeleton
GO:0032991	0.991	protein-containing complex
GO:0005829	0.984	cytosol
GO:0097542	0.949	ciliary tip
GO:0005815	0.946	microtubule organizing center
GO:0005813	0.808	centrosome
GO:0005875	0.794	microtubule associated complex
GO:1902494	0.733	catalytic complex
GO:0030286	0.709	dynein complex
GO:0005868	0.531	cytoplasmic dynein complex
GO:0036064	0.500	ciliary basal body
GO:0099568	0.376	cytoplasmic region
GO:0035869	0.366	ciliary transition zone
GO:0097014	0.365	ciliary plasm
GO:0005930	0.343	axoneme
GO:0031514	0.342	motile cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]