StarFunc result for job id Q8TCY5

User Input

>input (172 residues)
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSASPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPD
QPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TCY5	1.000	1.000	3.715E-26	172	1.000	1.000	Q8TCY5.pdb.gz	MRAP_HUMAN Melanocortin-2 receptor accessory protein OS=Homo sapiens OX=9606 GN=MRAP PE=1 SV=2
2	AFDB:B0S5V9	0.144	0.054	9.784E-2	661	0.180	0.047	B0S5V9.pdb.gz
3	AFDB:F4IMT0	0.188	0.144	2.156E-1	230	0.163	0.122	F4IMT0.pdb.gz	F4IMT0_ARATH Epidermal patterning factor-like protein OS=Arabidopsis thaliana OX=3702 GN=CHAL PE=3 SV=1
4	AFDB:Q92823	0.163	0.026	4.114E-1	1304	0.145	0.019	Q92823.pdb.gz	NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo sapiens OX=9606 GN=NRCAM PE=1 SV=3
5	AFDB:Q9Z209	0.156	0.083	5.103E-1	374	0.105	0.048	Q9Z209.pdb.gz	LAYN_CRIGR Layilin OS=Cricetulus griseus OX=10029 GN=LAYN PE=1 SV=1
6	AFDB:Q8R411	0.194	0.178	5.483E-1	188	0.174	0.160	Q8R411.pdb.gz	MYCT1_MOUSE Myc target protein 1 OS=Mus musculus OX=10090 GN=Myct1 PE=1 SV=1
7	AFDB:O88472	0.168	0.157	9.065E-1	185	0.140	0.130	O88472.pdb.gz	TNR17_MOUSE Tumor necrosis factor receptor superfamily member 17 OS=Mus musculus OX=10090 GN=Tnfrsf17 PE=2 SV=1
8	AFDB:Q586U8	0.118	0.053	9.740E-1	762	0.116	0.026	Q586U8.pdb.gz	Q586U8_TRYB2 Paraflagellar rod protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.515 PE=4 SV=1
9	AFDB:F4JNK0	0.186	0.155	1.047	208	0.134	0.111	F4JNK0.pdb.gz	F4JNK0_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=AIRP1 PE=1 SV=1
10	AFDB:A8MS11	0.165	0.139	1.124	210	0.134	0.110	A8MS11.pdb.gz	A8MS11_ARATH Ankyrin repeat protein OS=Arabidopsis thaliana OX=3702 GN=At1g73350 PE=1 SV=1
11	PDB:6c24C	0.175	0.201	1.722	148	0.140	0.162	6c24C.pdb.gz	Structures of human PRC2 with its cofactors AEBP2 and JARID2.
12	PDB:6wkrC	0.172	0.056	4.706	606	0.128	0.036	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
13	PDB:7qooU	0.231	0.216	5.433	186	0.087	0.081	7qooU.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
14	PDB:5wg6A	0.165	0.061	6.272	517	0.105	0.035	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TCY5	1.08e-126	354	172	1.000	1.000	MRAP_HUMAN Melanocortin-2 receptor accessory protein OS=Homo sapiens OX=9606 GN=MRAP PE=1 SV=2
2	Q9D159	2.28e-40	134	127	0.477	0.646	MRAP_MOUSE Melanocortin-2 receptor accessory protein OS=Mus musculus OX=10090 GN=Mrap PE=1 SV=1
3	Q96G30	5.28e-11	60.8	205	0.163	0.137	MRAP2_HUMAN Melanocortin-2 receptor accessory protein 2 OS=Homo sapiens OX=9606 GN=MRAP2 PE=1 SV=2
4	F8W4H9	5.73e-11	60.8	217	0.233	0.184	MRP2A_DANRE Melanocortin-2 receptor accessory protein 2A OS=Danio rerio OX=7955 GN=mrap2a PE=1 SV=1
5	D3Z1Q2	1.80e-10	59.3	207	0.151	0.126	MRAP2_MOUSE Melanocortin-2 receptor accessory protein 2 OS=Mus musculus OX=10090 GN=Mrap2 PE=1 SV=2
6	P0DM64	1.35e-08	53.9	199	0.157	0.136	MRP2B_DANRE Melanocortin-2 receptor accessory protein 2B OS=Danio rerio OX=7955 GN=mrap2b PE=1 SV=1
7	Q9SF09	0.88	32.0	432	0.076	0.030	ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana OX=3702 GN=ANT1 PE=1 SV=1
8	Q93ZV8	1.5	31.6	605	0.128	0.036	Q93ZV8_ARATH RNI-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB2004 PE=1 SV=1
9	F4KHF4	2.6	30.8	489	0.064	0.022	F4KHF4_ARATH beta-ketoacyl-[acyl-carrier-protein] synthase I OS=Arabidopsis thaliana OX=3702 GN=KASI PE=1 SV=1
10	Q9LI83	3.2	30.8	1202	0.122	0.017	ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana OX=3702 GN=ALA10 PE=3 SV=1
11	E9PNS8	3.9	29.3	120	0.081	0.117	E9PNS8_HUMAN Junction adhesion molecule like (Fragment) OS=Homo sapiens OX=9606 GN=JAML PE=1 SV=8
12	O96695	7.7	29.6	2098	0.122	0.010	O96695_DROME Rough deal protein OS=Drosophila melanogaster OX=7227 GN=rod PE=4 SV=1
13	Q9V9W7	7.7	29.6	2089	0.122	0.010	Q9V9W7_DROME Rough deal OS=Drosophila melanogaster OX=7227 GN=rod PE=1 SV=2
14	E9PJJ4	8.3	28.5	155	0.081	0.090	E9PJJ4_HUMAN Junction adhesion molecule like (Fragment) OS=Homo sapiens OX=9606 GN=JAML PE=1 SV=1
15	A0A1W2PRS4	8.8	28.9	220	0.081	0.064	A0A1W2PRS4_HUMAN Junction adhesion molecule like (Fragment) OS=Homo sapiens OX=9606 GN=JAML PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15183 MRAP	7.2e-46	165.4	Melanocortin-2 receptor accessory protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382684

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333821	0.998	Adrenocorticotropic hormone receptor
2	9606.ENSP00000384092	0.946	Pro-opiomelanocortin
3	9606.ENSP00000243911	0.768	Melanocortin receptor 3
4	9606.ENSP00000364631	0.766	FYVE, RhoGEF and PH domain-containing protein 3
5	9606.ENSP00000299766	0.760	Melanocortin receptor 4
6	9606.ENSP00000451605	0.679	Melanocyte-stimulating hormone receptor
7	9606.ENSP00000318077	0.669	Melanocortin receptor 5
8	9606.ENSP00000454804	0.649	Agouti-signaling protein
9	9606.ENSP00000257776	0.623	Melanocortin-2 receptor accessory protein 2
10	9606.ENSP00000360141	0.611	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
11	9606.ENSP00000311712	0.529	Receptor-transporting protein 1
12	9606.ENSP00000276449	0.502	Steroidogenic acute regulatory protein, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0031782	1.000	type 4 melanocortin receptor binding
GO:0070996	0.988	type 1 melanocortin receptor binding
GO:0031781	0.988	type 3 melanocortin receptor binding
GO:0031783	0.984	type 5 melanocortin receptor binding
GO:0031780	0.984	corticotropin hormone receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0048518	0.973	positive regulation of biological process
GO:0106070	0.971	regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0048519	0.968	negative regulation of biological process
GO:0048522	0.964	positive regulation of cellular process
GO:0009967	0.936	positive regulation of signal transduction
GO:0008104	0.925	protein localization
GO:0045745	0.915	positive regulation of G protein-coupled receptor signaling pathway
GO:1904375	0.900	regulation of protein localization to cell periphery
GO:1990778	0.896	protein localization to cell periphery
GO:0048523	0.888	negative regulation of cellular process
GO:0051668	0.885	localization within membrane
GO:0010648	0.850	negative regulation of cell communication
GO:0072657	0.845	protein localization to membrane
GO:1905475	0.794	regulation of protein localization to membrane
GO:0072659	0.783	protein localization to plasma membrane
GO:1903076	0.779	regulation of protein localization to plasma membrane
GO:1903828	0.769	negative regulation of protein localization
GO:0045744	0.722	negative regulation of G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005783	0.996	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]