StarFunc result for job id Q8TCZ2

User Input

>input (262 residues)
MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTT
RAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFD
LADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGM
VAEPGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQ
VKYSTLHTQSAEPPPPPEPARI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TCZ2	1.000	1.000	3.588E-39	262	1.000	1.000	Q8TCZ2.pdb.gz	C99L2_HUMAN CD99 antigen-like protein 2 OS=Homo sapiens OX=9606 GN=CD99L2 PE=1 SV=1
2	AFDB:Q8R1R5	0.226	0.236	3.500E-19	246	0.626	0.667	Q8R1R5.pdb.gz	C99L2_RAT CD99 antigen-like protein 2 OS=Rattus norvegicus OX=10116 GN=Cd99l2 PE=2 SV=1
3	AFDB:Q91ZR3	0.112	0.083	3.758E-2	358	0.172	0.126	Q91ZR3.pdb.gz	ZHANG_MOUSE CREB/ATF bZIP transcription factor OS=Mus musculus OX=10090 GN=Crebzf PE=1 SV=2
4	AFDB:P27705	0.144	0.084	1.411E-1	504	0.118	0.062	P27705.pdb.gz	MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIG1 PE=1 SV=1
5	AFDB:Q8IYJ0	0.152	0.144	1.610E-1	282	0.172	0.160	Q8IYJ0.pdb.gz	PIANP_HUMAN PILR alpha-associated neural protein OS=Homo sapiens OX=9606 GN=PIANP PE=1 SV=1
6	AFDB:Q9NTI7	0.107	0.096	2.241E-1	297	0.164	0.145	Q9NTI7.pdb.gz	INKA2_HUMAN PAK4-inhibitor INKA2 OS=Homo sapiens OX=9606 GN=INKA2 PE=1 SV=1
7	AFDB:O74337	0.102	0.106	2.394E-1	249	0.111	0.116	O74337.pdb.gz	YH24_SCHPO Uncharacterized protein C1A4.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1A4.04 PE=4 SV=1
8	AFDB:Q86UQ0	0.134	0.103	2.920E-1	364	0.130	0.093	Q86UQ0.pdb.gz	ZN589_HUMAN Zinc finger protein 589 OS=Homo sapiens OX=9606 GN=ZNF589 PE=1 SV=1
9	AFDB:Q54JD4	0.100	0.101	5.656E-1	265	0.134	0.132	Q54JD4.pdb.gz	Y8133_DICDI Uncharacterized protein DDB_G0288133 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288133 PE=3 SV=1
10	AFDB:Q9UDY2	0.118	0.035	5.656E-1	1190	0.156	0.034	Q9UDY2.pdb.gz	ZO2_HUMAN Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2
11	PDB:5datSM	0.084	0.136	8.551	159	0.103	0.170	5datSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
12	PDB:6nmiC	0.118	0.080	8.551	408	0.092	0.059	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TCZ2	0.0	536	262	1.000	1.000	C99L2_HUMAN CD99 antigen-like protein 2 OS=Homo sapiens OX=9606 GN=CD99L2 PE=1 SV=1
2	Q8BIF0	8.21e-97	285	237	0.668	0.738	C99L2_MOUSE CD99 antigen-like protein 2 OS=Mus musculus OX=10090 GN=Cd99l2 PE=1 SV=1
3	Q8R1R5	9.46e-69	214	246	0.618	0.659	C99L2_RAT CD99 antigen-like protein 2 OS=Rattus norvegicus OX=10116 GN=Cd99l2 PE=2 SV=1
4	A0A0S2Z5R8	1.74e-66	204	119	0.370	0.815	A0A0S2Z5R8_HUMAN CD99 molecule-like 2 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=CD99L2 PE=1 SV=1
5	P14209	0.065	35.8	185	0.237	0.335	CD99_HUMAN CD99 antigen OS=Homo sapiens OX=9606 GN=CD99 PE=1 SV=1
6	P12576	4.3	31.2	2183	0.126	0.015	L_MEASE RNA-directed RNA polymerase L OS=Measles virus (strain Edmonston) OX=11235 GN=L PE=2 SV=1
7	Q8BHZ4	6.9	30.8	1262	0.061	0.013	ZN592_MOUSE Zinc finger protein 592 OS=Mus musculus OX=10090 GN=Znf592 PE=1 SV=3
8	O35185	9.3	30.0	411	0.061	0.039	BHE40_MOUSE Class E basic helix-loop-helix protein 40 OS=Mus musculus OX=10090 GN=Bhlhe40 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13840 ACT_7	1.4e+02	13.7	ACT domain
2	PF12301 CD99L2	8e-74	259.1	CD99 antigen like protein 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480322

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370588	0.827	CD99 antigen
2	9606.ENSP00000302310	0.743	Zinc finger protein 396
3	9606.ENSP00000455585	0.713	Zinc finger protein 853
4	9606.ENSP00000218316	0.694	Melatonin-related receptor
5	9606.ENSP00000379712	0.690	IQ motif and SEC7 domain-containing protein 2
6	9606.ENSP00000217901	0.673	Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
7	9606.ENSP00000287295	0.658	Apoptosis-inducing factor 1, mitochondrial
8	9606.ENSP00000002165	0.651	Plasma alpha-L-fucosidase
9	9606.ENSP00000006526	0.627	WD repeat-containing protein 54
10	9606.ENSP00000411004	0.613	Glycoprotein Xg
11	9606.ENSP00000247194	0.579	Trans-3-hydroxy-L-proline dehydratase
12	9606.ENSP00000355995	0.579	Corticosteroid 11-beta-dehydrogenase isozyme 1
13	9606.ENSP00000316905	0.561	Sideroflexin-1
14	9606.ENSP00000472305	0.538	Zinc finger protein 358
15	9606.ENSP00000352941	0.517	BTB/POZ domain-containing protein KCTD18
16	9606.ENSP00000359393	0.514	High mobility group protein B3
17	9606.ENSP00000481917	0.508	Seizure 6-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0002684	0.973	positive regulation of immune system process
GO:0030335	0.970	positive regulation of cell migration
GO:0050900	0.959	leukocyte migration
GO:0002685	0.951	regulation of leukocyte migration
GO:0002687	0.940	positive regulation of leukocyte migration
GO:0045123	0.920	cellular extravasation
GO:1902622	0.883	regulation of neutrophil migration
GO:0002691	0.883	regulation of cellular extravasation
GO:0071675	0.859	regulation of mononuclear cell migration
GO:2000401	0.843	regulation of lymphocyte migration
GO:0071677	0.805	positive regulation of mononuclear cell migration
GO:1902624	0.795	positive regulation of neutrophil migration
GO:2000404	0.772	regulation of T cell migration
GO:2000403	0.417	positive regulation of lymphocyte migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0070161	0.979	anchoring junction
GO:0016020	0.965	membrane
GO:0071944	0.744	cell periphery
GO:0005886	0.710	plasma membrane
GO:0005622	0.649	intracellular anatomical structure
GO:0030055	0.577	cell-substrate junction
GO:0043227	0.536	membrane-bounded organelle
GO:0043231	0.526	intracellular membrane-bounded organelle
GO:0005925	0.459	focal adhesion
GO:0005737	0.453	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]