StarFunc result for job id Q8TD16

User Input

>input (824 residues)
MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQ
FEELEVDYEAIRSEMEQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLE
LQTELKQLRNVLTNTQSENERLASVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQD
YSELEEENISLQKQVSVLRQNQVEFEGLKHEIKRLEEETEYLNSQLEDAIRLKEISERQL
EEALETLKTEREQKNSLRKELSHYMSINDSFYTSHLHVSLDGLKFSDDAAEPNNDAEALV
NGFEHGGLAKLPLDNKTSTPKKEGLAPPSPSLVSDLLSELNISEIQKLKQQLMQMEREKA
GLLATLQDTQKQLEHTRGSLSEQQEKVTRLTENLSALRRLQASKERQTALDNEKDRDSHE
DGDYYEVDINGPEILACKYHVAVAEAGELREQLKALRSTHEAREAQHAEEKGRYEAEGQA
LTEKVSLLEKASRQDRELLARLEKELKKVSDVAGETQGSLSVAQDELVTFSEELANLYHH
VCMCNNETPNRVMLDYYREGQGGAGRTSPGGRTSPEARGRRSPILLPKGLLAPEAGRADG
GTGDSSPSPGSSLPSPLSDPRREPMNIYNLIAIIRDQIKHLQAAVDRTTELSRQRIASQE
LGPAVDKDKEALMEEILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKA
MVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNS
LLRMAIQQKLALTQRLELLELDHEQTRRGRAKAAPKTKPATPSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TD16	1.000	1.000	3.520E-98	824	1.000	1.000	Q8TD16.pdb.gz	BICD2_HUMAN Protein bicaudal D homolog 2 OS=Homo sapiens OX=9606 GN=BICD2 PE=1 SV=1
2	AFDB:Q96G01	0.398	0.349	4.180E-56	975	0.640	0.541	Q96G01.pdb.gz	BICD1_HUMAN Protein bicaudal D homolog 1 OS=Homo sapiens OX=9606 GN=BICD1 PE=1 SV=3
3	AFDB:P16568	0.329	0.343	2.860E-30	782	0.376	0.396	P16568.pdb.gz	BICD_DROME Protein bicaudal D OS=Drosophila melanogaster OX=7227 GN=BicD PE=1 SV=2
4	AFDB:V6CJ04	0.241	0.266	1.120E-15	737	0.267	0.299	V6CJ04.pdb.gz	BICD_CAEEL Protein bicaudal D homolog OS=Caenorhabditis elegans OX=6239 GN=bicd-1 PE=1 SV=1
5	AFDB:Q57XE6	0.132	0.103	2.059E-3	1179	0.163	0.114	Q57XE6.pdb.gz	Q57XE6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.270 PE=4 SV=1
6	AFDB:E9Q7G0	0.137	0.069	3.048E-3	2094	0.178	0.070	E9Q7G0.pdb.gz	NUMA1_MOUSE Nuclear mitotic apparatus protein 1 OS=Mus musculus OX=10090 GN=Numa1 PE=1 SV=1
7	AFDB:Q08379	0.146	0.124	5.411E-2	1002	0.193	0.159	Q08379.pdb.gz	GOGA2_HUMAN Golgin subfamily A member 2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=3
8	AFDB:Q380Z7	0.091	0.048	9.128E-2	2059	0.102	0.041	Q380Z7.pdb.gz	Q380Z7_TRYB2 Flagellar Member 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8650 PE=4 SV=1
9	AFDB:Q8N6Y0	0.113	0.131	1.111E-1	703	0.127	0.149	Q8N6Y0.pdb.gz	USBP1_HUMAN Harmonin-binding protein USHBP1 OS=Homo sapiens OX=9606 GN=USHBP1 PE=1 SV=1
10	AFDB:Q07732	0.133	0.138	1.540E-1	790	0.101	0.105	Q07732.pdb.gz	ADY3_YEAST Accumulates dyads protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADY3 PE=1 SV=2
11	PDB:6k15J	0.042	0.098	3.537	235	0.021	0.072	6k15J.pdb.gz	Structure of the RSC complex bound to the nucleosome.
12	PDB:6id0L	0.079	0.129	5.966	475	0.045	0.078	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
13	PDB:7emfK	0.046	0.278	5.966	112	0.011	0.080	7emfK.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:5n9jZ	0.042	0.258	6.369	119	0.016	0.109	5n9jZ.pdb.gz
15	PDB:7enag	0.048	0.232	7.259	166	0.021	0.102	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:4gwpA	0.042	0.261	8.273	112	0.010	0.071	4gwpA.pdb.gz
17	PDB:7r5jB0	0.065	0.036	8.273	1748	0.028	0.013	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:3jb9W	0.076	0.134	8.832	426	0.036	0.070	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4ADZ2	0.0	984	877	0.641	0.602	D4ADZ2_RAT BICD cargo adaptor 1 OS=Rattus norvegicus OX=10116 GN=Bicd1 PE=3 SV=2
2	Q8BR07	0.0	989	835	0.642	0.634	BICD1_MOUSE Protein bicaudal D homolog 1 OS=Mus musculus OX=10090 GN=Bicd1 PE=1 SV=2
3	Q8TD16	0.0	1659	824	1.000	1.000	BICD2_HUMAN Protein bicaudal D homolog 2 OS=Homo sapiens OX=9606 GN=BICD2 PE=1 SV=1
4	Q921C5	0.0	1537	820	0.950	0.955	BICD2_MOUSE Protein bicaudal D homolog 2 OS=Mus musculus OX=10090 GN=Bicd2 PE=1 SV=1
5	Q96G01	0.0	993	975	0.646	0.546	BICD1_HUMAN Protein bicaudal D homolog 1 OS=Homo sapiens OX=9606 GN=BICD1 PE=1 SV=3
6	P16568	9.26e-142	439	782	0.397	0.418	BICD_DROME Protein bicaudal D OS=Drosophila melanogaster OX=7227 GN=BicD PE=1 SV=2
7	V6CJ04	8.59e-40	159	737	0.153	0.171	BICD_CAEEL Protein bicaudal D homolog OS=Caenorhabditis elegans OX=6239 GN=bicd-1 PE=1 SV=1
8	F1M614	6.31e-04	46.2	3117	0.158	0.042	F1M614_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=4 SV=4
9	A0A0G2JWX2	6.37e-04	46.2	3121	0.142	0.037	A0A0G2JWX2_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1
10	A0A8I5ZPP7	0.001	45.4	3137	0.142	0.037	A0A8I5ZPP7_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1
11	Q960M7	0.021	40.8	931	0.090	0.079	Q960M7_DROME LD44526p OS=Drosophila melanogaster OX=7227 GN=corn PE=2 SV=1
12	Q967H1	0.029	40.4	960	0.090	0.077	Q967H1_DROME Cornetto OS=Drosophila melanogaster OX=7227 GN=corn PE=2 SV=1
13	Q9VS25	0.030	40.4	960	0.090	0.077	Q9VS25_DROME Cornetto, isoform B OS=Drosophila melanogaster OX=7227 GN=corn PE=4 SV=2
14	M9PBT2	0.032	40.4	970	0.090	0.076	M9PBT2_DROME Cornetto, isoform E OS=Drosophila melanogaster OX=7227 GN=corn PE=4 SV=1
15	M9PHM1	0.043	40.0	1101	0.089	0.066	M9PHM1_DROME Cornetto, isoform D OS=Drosophila melanogaster OX=7227 GN=corn PE=4 SV=1
16	Q8IQ73	0.043	40.0	1107	0.089	0.066	Q8IQ73_DROME Cornetto, isoform C OS=Drosophila melanogaster OX=7227 GN=corn PE=4 SV=2
17	Q0WVX5	0.49	36.6	1040	0.079	0.062	SSY4_ARATH Probable starch synthase 4, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=SS4 PE=1 SV=1
18	Q8VD75	0.80	35.8	1029	0.049	0.039	HIP1_MOUSE Huntingtin-interacting protein 1 OS=Mus musculus OX=10090 GN=Hip1 PE=1 SV=2
19	Q9WVQ0	1.3	35.0	1022	0.046	0.037	PMFBP_MOUSE Polyamine-modulated factor 1-binding protein 1 OS=Mus musculus OX=10090 GN=Pmfbp1 PE=2 SV=1
20	Q9USI6	1.4	35.0	1526	0.068	0.037	MYO2_SCHPO Myosin type-2 heavy chain 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=myo2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	56	15.3	Afadin- and alpha -actinin-Binding
2	PF09730 BicD	0	1273.9	Microtubule-associated protein Bicaudal-D

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349351

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311449	0.996	Ras-related protein Rab-6A
2	9606.ENSP00000283195	0.994	E3 SUMO-protein ligase RanBP2
3	9606.ENSP00000273130	0.991	Cytoplasmic dynein 1 light intermediate chain 1
4	9606.ENSP00000348965	0.989	Cytoplasmic dynein 1 heavy chain 1
5	9606.ENSP00000354791	0.968	Dynactin subunit 1
6	9606.ENSP00000380378	0.958	Platelet-activating factor acetylhydrolase IB subunit alpha
7	9606.ENSP00000408910	0.952	Dynactin subunit 2
8	9606.ENSP00000305699	0.942	Protein Hook homolog 3
9	9606.ENSP00000320130	0.941	Cytoplasmic dynein 1 intermediate chain 1
10	9606.ENSP00000376297	0.926	Dynein light chain 1, cytoplasmic
11	9606.ENSP00000238616	0.915	Serine/threonine-protein kinase Nek9
12	9606.ENSP00000351832	0.912	Rab3 GTPase-activating protein non-catalytic subunit
13	9606.ENSP00000380308	0.903	Cytoplasmic dynein 1 intermediate chain 2
14	9606.ENSP00000478479	0.901	Ras-related protein Rab-18
15	9606.ENSP00000411418	0.900	Rab3 GTPase-activating protein catalytic subunit
16	9606.ENSP00000415056	0.884	piRNA biogenesis protein EXD1
17	9606.ENSP00000258198	0.855	Cytoplasmic dynein 1 light intermediate chain 2
18	9606.ENSP00000358921	0.850	Alpha-centractin
19	9606.ENSP00000355922	0.834	Centromere protein F
20	9606.ENSP00000285208	0.824	Ras-related protein Rab-6B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.647	protein-containing complex binding
GO:0060090	0.413	molecular adaptor activity
GO:0070840	0.402	dynein complex binding
GO:0030674	0.394	protein-macromolecule adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.976	biological regulation
GO:0016043	0.965	cellular component organization
GO:0050789	0.964	regulation of biological process
GO:0050794	0.926	regulation of cellular process
GO:0051234	0.894	establishment of localization
GO:0033365	0.882	protein localization to organelle
GO:0006810	0.872	transport
GO:0016192	0.741	vesicle-mediated transport
GO:0051128	0.725	regulation of cellular component organization
GO:0032886	0.719	regulation of microtubule-based process
GO:0048193	0.682	Golgi vesicle transport
GO:0034067	0.601	protein localization to Golgi apparatus
GO:0006890	0.582	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006996	0.521	organelle organization
GO:0061842	0.520	microtubule organizing center localization
GO:0051649	0.490	establishment of localization in cell
GO:0007017	0.457	microtubule-based process
GO:0033043	0.394	regulation of organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.997	Golgi apparatus
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0016020	0.982	membrane
GO:0005829	0.981	cytosol
GO:0031982	0.949	vesicle
GO:0032991	0.935	protein-containing complex
GO:0005634	0.860	nucleus
GO:0005886	0.855	plasma membrane
GO:0005856	0.835	cytoskeleton
GO:0015630	0.725	microtubule cytoskeleton
GO:0005815	0.689	microtubule organizing center
GO:0005635	0.659	nuclear envelope
GO:0005813	0.619	centrosome
GO:0140513	0.577	nuclear protein-containing complex
GO:0031410	0.551	cytoplasmic vesicle
GO:0042175	0.431	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0070013	0.420	intracellular organelle lumen
GO:0031981	0.412	nuclear lumen
GO:0005643	0.407	nuclear pore
GO:0005642	0.383	annulate lamellae
GO:0005654	0.379	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]