StarFunc result for job id Q8TD26

User Input

>input (1400 residues)
MKMKIQKKEKQLSNLKVLNHSPMSDASVNFDYKSPSPFDCSTDQEEKIEDVASHCLPQKD
LYTAEEEAATLFPRKMTSHNGMEDSGGGGTGVKKKRKKKEPGDQEGAAKGSKDREPKPKR
KREPKEPKEPRKAKEPKKAKEHKEPKQKDGAKKARKPREASGTKEAKEKRSCTDSAARTK
SRKASKEQGPTPVEKKKKGKRKSETTVESLELDQGLTNPSLRSPEESTESTDSQKRRSGR
QVKRRKYNEDLDFKVVDDDGETIAVLGAGRTSALSASTLAWQAEEPPEDDANIIEKILAS
KTVQEVHPGEPPFDLELFYVKYRNFSYLHCKWATMEELEKDPRIAQKIKRFRNKQAQMKH
IFTEPDEDLFNPDYVEVDRILEVAHTKDAETGEEVTHYLVKWCSLPYEESTWELEEDVDP
AKVKEFESLQVLPEIKHVERPASDSWQKLEKSREYKNSNQLREYQLEGMNWLLFNWYNRK
NCILADEMGLGKTIQSITFLSEIFLRGIHGPFLIIAPLSTITNWEREFRTWTEMNAIVYH
GSQISRQMIQQYEMVYRDAQGNPLSGVFKFHVVITTFEMILADCPELKKIHWSCVIIDEA
HRLKNRNCKLLEGLKLMALEHKVLLTGTPLQNSVEELFSLLNFLEPSQFPSETAFLEEFG
DLKTEEQVKKLQSILKPMMLRRLKDDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFS
FLTKGANQHNMPNLINTMMELRKCCNHPYLINGAEEKILEDFRKTHSPDAPDFQLQAMIQ
AAGKLVLIDKLLPKLIAGGHKVLIFSQMVRCLDILEDYLIQRRYTYERIDGRVRGNLRQA
AIDRFCKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSK
AVKVYRLITRNSYEREMFDKASLKLGLDKAVLQDINRKGGTNGVQQLSKMEVEDLLRKGA
YGALMDEEDEGSKFCEEDIDQILQRRTHTITIQSEGKGSTFAKASFVASGNRTDISLDDP
NFWQKWAKIAELDTEAKNEKESLVIDRPRVRKQTKHYNSFEEDELMEFSELDSDSDERPT
RSRRLNDKARRYLRAECFRVEKNLLIFGWGRWKDILTHGRFKWHLNEKDMEMICRALLVY
CVKHYKGDEKIKSFIWELITPTKDGQAQTLQNHSGLSAPVPRGRKGKKTKNQLLIPELKD
ADWLATCNPEVVLHDDGYKKHLKQHCNKVLLRVRMLYYLKAEILGEAAEKAFEGSPAREL
DVPLPDIDYMEIPVDWWDAEADKSLLIGVFKHGYERYNAMRADPALCFLEKVGMPDEKSL
SAEQGVTDGTSDIPERGNTDKEDNAEDKVDGLQKQTESSSDGGDGVFSEKKDDSRAAQDG
SDPDKSPWPVSSALTARLRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7KU24	0.488	0.368	1.696E-69	1883	0.291	0.217	Q7KU24.pdb.gz	CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Chd1 PE=1 SV=1
2	PDB:6g0lM	0.390	0.626	1.817E-43	855	0.221	0.363	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
3	PDB:6g0lW	0.397	0.620	3.114E-42	878	0.228	0.363	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
4	PDB:6jylK	0.303	0.816	5.462E-37	504	0.166	0.462	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
5	PDB:7epuB	0.243	0.399	9.414E-33	748	0.163	0.305	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
6	PDB:6tdaS	0.305	0.534	7.562E-32	783	0.144	0.257	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
7	PDB:7oo3b	0.289	0.716	6.678E-31	534	0.115	0.301	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
8	PDB:6uxwA	0.309	0.542	3.851E-30	778	0.146	0.263	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
9	AFDB:Q9GQN5	0.307	0.326	2.358E-29	1311	0.156	0.167	Q9GQN5.pdb.gz	ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster OX=7227 GN=XNP PE=1 SV=2
10	PDB:6gejM	0.291	0.577	1.870E-28	688	0.134	0.272	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
11	PDB:6kw3Y	0.310	0.751	5.827E-28	548	0.150	0.383	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
12	PDB:5vvrM	0.264	0.677	6.876E-24	503	0.102	0.284	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
13	AFDB:Q22308	0.195	0.256	2.301E-9	1022	0.079	0.108	Q22308.pdb.gz	Q22308_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-19 PE=1 SV=2
14	AFDB:A0A2R8RUE4	0.208	0.203	3.205E-9	1439	0.118	0.115	A0A2R8RUE4.pdb.gz
15	AFDB:O76743	0.201	0.238	5.395E-9	1156	0.091	0.111	O76743.pdb.gz	GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans OX=6239 GN=glh-4 PE=1 SV=2
16	AFDB:Q9VGI8	0.201	0.190	1.016E-7	1487	0.120	0.113	Q9VGI8.pdb.gz	BLM_DROME RecQ-like DNA helicase Blm OS=Drosophila melanogaster OX=7227 GN=Blm PE=1 SV=1
17	AFDB:P90897	0.203	0.284	1.117E-7	959	0.103	0.150	P90897.pdb.gz	RDE12_CAEEL DEAD-box ATP-dependent RNA helicase rde-12 OS=Caenorhabditis elegans OX=6239 GN=rde-12 PE=1 SV=4
18	AFDB:Q9JIK5	0.187	0.294	1.350E-7	851	0.106	0.175	Q9JIK5.pdb.gz	DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus OX=10090 GN=Ddx21 PE=1 SV=3
19	AFDB:F4IDQ6	0.150	0.137	2.682E-3	1576	0.066	0.058	F4IDQ6.pdb.gz	NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana OX=3702 GN=NIH PE=1 SV=1
20	AFDB:A0A2R8QD21	0.045	0.037	1.010E-2	1989	0.111	0.078	A0A2R8QD21.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y4P3	785	1102	0.282	0.358	A0A2R8Y4P3_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=1
2	A0A2R8Y840	1693	1995	0.610	0.428	A0A2R8Y840_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=1
3	A2AJK6	1742	2986	0.605	0.284	CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus OX=10090 GN=Chd7 PE=1 SV=1
4	B0R0I6	1562	2511	0.556	0.310	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
5	B7Z002	1239	5517	0.441	0.112	B7Z002_DROME Kismet, isoform C OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
6	F1QGL1	1703	3140	0.596	0.266	F1QGL1_DANRE DNA helicase OS=Danio rerio OX=7955 GN=chd7 PE=1 SV=1
7	H0YJG4	1463	1815	0.505	0.390	H0YJG4_HUMAN Chromodomain helicase DNA binding protein 8 (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=2
8	H3BTW3	1691	2424	0.607	0.351	H3BTW3_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD9 PE=1 SV=9
9	M9NCY5	1224	5343	0.441	0.116	M9NCY5_DROME Kismet, isoform D OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
10	M9NDB7	1186	5252	0.421	0.112	M9NDB7_DROME Kismet, isoform E OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
11	M9NEL3	1237	5191	0.441	0.119	M9NEL3_DROME Kismet, isoform F OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
12	Q09XV5	1698	2582	0.615	0.333	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
13	Q3L8U1	1692	2897	0.608	0.294	CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens OX=9606 GN=CHD9 PE=1 SV=2
14	Q54CF8	600	3071	0.239	0.109	Q54CF8_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293012 PE=4 SV=1
15	Q54UZ8	743	2373	0.292	0.172	Q54UZ8_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280705 PE=4 SV=1
16	Q8TD26	2907	2715	1.000	0.516	CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens OX=9606 GN=CHD6 PE=1 SV=4
17	Q9HCK8	1697	2581	0.601	0.326	CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=5
18	Q9JIX5	1699	2581	0.615	0.334	CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus OX=10116 GN=Chd8 PE=1 SV=2
19	Q9P2D1	1734	2997	0.593	0.277	CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens OX=9606 GN=CHD7 PE=1 SV=3
20	Q9VPL9	1238	5322	0.441	0.116	Q9VPL9_DROME FI24801p1 OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08074 CHDCT2	17	16.9	CHDCT2 (NUC038) domain
2	PF00385 Chromo	8e-21	85.0	Chromo (CHRromatin Organisation MOdifier) domain
3	PF00270 DEAD	0.25	22.6	DEAD/DEAH box helicase
4	PF11919 DUF3437	85	14.4	Domain of unknown function (DUF3437)
5	PF11496 HDA2-3	68	14.1	Class II histone deacetylase complex subunits 2 and 3
6	PF00271 Helicase_C	2.1e-13	62.0	Helicase conserved C-terminal domain
7	PF04851 ResIII	3.6e-05	35.3	Type III restriction enzyme, res subunit
8	PF00176 SNF2-rel_dom	2.3e-64	228.9	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003825948.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008963004.1	0.934	Bromodomain PHD finger transcription factor
2	9597.XP_008958403.1	0.918	Belongs to the histone H2B family.
3	9597.XP_003804484.2	0.821	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
4	9597.XP_003804794.1	0.788	SPT16 homolog, facilitates chromatin remodeling subunit
5	9597.XP_003812729.1	0.746	Transcription elongation factor that enhances transcription elongation by RNA polymerase II (RNAPII).
6	9597.XP_003825805.1	0.709	AT-rich interaction domain 2
7	9597.XP_008950096.1	0.709	Structure specific recognition protein 1
8	9597.XP_003829732.2	0.695	Histone H3.1-like
9	9597.XP_003829744.2	0.695	Histone H3.1-like
10	9597.XP_008958120.1	0.695	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
11	9597.XP_008959404.1	0.695	Belongs to the MHC class I family.
12	9597.XP_003824269.1	0.641	Myb like, SWIRM and MPN domains 1
13	9597.XP_003824539.1	0.638	AT-rich interactive domain-containing protein 4B isoform X1
14	9597.XP_008955261.1	0.638	AT-rich interaction domain 4A
15	9597.XP_003830776.1	0.627	ASH2 like histone lysine methyltransferase complex subunit
16	9597.XP_008974195.1	0.624	Proline rich coiled-coil 2B
17	9597.XP_008975230.1	0.615	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 26 ESTs, 2 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 11 samples with support for all annotated introns
18	9597.XP_003818189.1	0.606	Zinc finger protein 143 isoform X1
19	9597.XP_008964822.1	0.603	Lysine-specific histone demethylase 1A isoform X1
20	9597.XP_003804675.1	0.597	Belongs to the SNF5 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008094	0.997	ATP-dependent activity, acting on DNA
GO:0008134	0.995	transcription factor binding
GO:1901363	0.957	heterocyclic compound binding
GO:0097159	0.951	organic cyclic compound binding
GO:0003682	0.922	chromatin binding
GO:0003676	0.922	nucleic acid binding
GO:0042393	0.765	histone binding
GO:0140030	0.757	modification-dependent protein binding
GO:0140658	0.749	ATP-dependent chromatin remodeler activity
GO:0003677	0.727	DNA binding
GO:0001221	0.694	transcription coregulator binding
GO:0000976	0.351	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.976	regulation of metabolic process
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0050794	0.920	regulation of cellular process
GO:0080090	0.907	regulation of primary metabolic process
GO:0010468	0.898	regulation of gene expression
GO:0051171	0.897	regulation of nitrogen compound metabolic process
GO:0031323	0.885	regulation of cellular metabolic process
GO:0051252	0.875	regulation of RNA metabolic process
GO:0006355	0.869	regulation of DNA-templated transcription
GO:0048518	0.789	positive regulation of biological process
GO:0009987	0.787	cellular process
GO:0045454	0.727	cell redox homeostasis
GO:0009893	0.716	positive regulation of metabolic process
GO:0051173	0.700	positive regulation of nitrogen compound metabolic process
GO:0048522	0.693	positive regulation of cellular process
GO:0010604	0.664	positive regulation of macromolecule metabolic process
GO:0031325	0.646	positive regulation of cellular metabolic process
GO:0006357	0.620	regulation of transcription by RNA polymerase II
GO:0045935	0.576	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.557	positive regulation of RNA metabolic process
GO:0045893	0.553	positive regulation of DNA-templated transcription
GO:0045944	0.510	positive regulation of transcription by RNA polymerase II
GO:0008152	0.363	metabolic process
GO:0071840	0.321	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.576	intracellular non-membrane-bounded organelle
GO:0032991	0.351	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]