StarFunc result for job id Q8TD30

User Input

>input (523 residues)
MQRAAALVRRGCGPRTPSSWGRSQSSAAAEASAVLKVRPERSRRERILTLESMNPQVKAV
EYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPN
LLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDN
IYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENC
WALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADE
VYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLH
PEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLT
EDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVP
GSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JV84	0.930	0.894	9.362E-92	544	0.937	0.901	A0A0G2JV84.pdb.gz	A0A0G2JV84_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
2	AFDB:P25409	0.922	0.972	2.654E-78	496	0.641	0.675	P25409.pdb.gz	ALAT1_RAT Alanine aminotransferase 1 OS=Rattus norvegicus OX=10116 GN=Gpt PE=1 SV=2
3	AFDB:P24298	0.919	0.969	5.149E-77	496	0.637	0.671	P24298.pdb.gz	ALAT1_HUMAN Alanine aminotransferase 1 OS=Homo sapiens OX=9606 GN=GPT PE=1 SV=3
4	PDB:3ihjA	0.820	0.928	1.730E-73	461	0.868	0.985	3ihjA.pdb.gz	Human glutamate pyruvate transaminase 2
5	AFDB:Q9VYD9	0.906	0.825	5.470E-67	575	0.522	0.475	Q9VYD9.pdb.gz	Q9VYD9_DROME alanine transaminase OS=Drosophila melanogaster OX=7227 GN=ALT PE=1 SV=3
6	AFDB:Q7TP13	0.868	0.580	2.285E-66	789	0.740	0.490	Q7TP13.pdb.gz	Q7TP13_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
7	AFDB:Q9LDV4	0.893	0.865	4.568E-60	540	0.434	0.420	Q9LDV4.pdb.gz	ALAT2_ARATH Alanine aminotransferase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALAAT2 PE=1 SV=1
8	AFDB:F4I7I0	0.883	0.851	5.953E-60	543	0.442	0.425	F4I7I0.pdb.gz	ALAT1_ARATH Alanine aminotransferase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALAAT1 PE=1 SV=1
9	AFDB:P52893	0.884	0.782	5.502E-59	592	0.438	0.387	P52893.pdb.gz	ALAM_YEAST Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALT1 PE=1 SV=1
10	AFDB:P52892	0.883	0.911	4.824E-58	507	0.434	0.448	P52892.pdb.gz	ALAT_YEAST Probable alanine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALT2 PE=1 SV=1
11	AFDB:Q9LR30	0.877	0.953	2.490E-57	481	0.423	0.459	Q9LR30.pdb.gz	GGT1_ARATH Glutamate--glyoxylate aminotransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GGAT1 PE=1 SV=1
12	PDB:4cvqA	0.673	0.858	9.216E-31	404	0.207	0.267	4cvqA.pdb.gz	Structural analysis and mutant growth properties reveal distinctive enzymatic and cellular roles for the three major L-alanine transaminases of Escherichia coli.
13	PDB:1b8gB	0.637	0.771	2.892E-23	425	0.157	0.193	1b8gB.pdb.gz	Structure of 1-aminocyclopropane-1-carboxylate synthase, a key enzyme in the biosynthesis of the plant hormone ethylene.
14	PDB:5wmlA	0.654	0.832	2.673E-22	404	0.155	0.200	5wmlA.pdb.gz	Structural basis for substrate recognition and inhibition of prephenate aminotransferase from Arabidopsis.
15	PDB:5yhvA	0.641	0.834	5.321E-22	394	0.172	0.228	5yhvA.pdb.gz	Crystal structure of an aminotransferase from Mycobacterium tuberculosis
16	PDB:3b46B	0.657	0.796	8.805E-21	425	0.149	0.184	3b46B.pdb.gz
17	PDB:2o0rA	0.637	0.847	1.495E-20	385	0.153	0.208	2o0rA.pdb.gz	The Three-dimensional Structure of N-Succinyldiaminopimelate Aminotransferase from Mycobacterium tuberculosis
18	PDB:6l1lB	0.653	0.853	2.976E-20	393	0.161	0.214	6l1lB.pdb.gz	Structural insights into the catalytic mechanism of Bacillus subtilis BacF.
19	PDB:3fvsA	0.616	0.752	5.618E-20	419	0.155	0.193	3fvsA.pdb.gz	Structural insight into the inhibition of human kynurenine aminotransferase I/glutamine transaminase K
20	PDB:7dlwB	0.644	0.789	1.179E-19	419	0.155	0.193	7dlwB.pdb.gz	Dual activities of ACC synthase: Novel clues regarding the molecular evolution of ACS genes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JV84	0.0	1000	544	0.937	0.901	A0A0G2JV84_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
2	A0A8I6ACI1	0.0	1001	531	0.937	0.923	A0A8I6ACI1_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
3	A0A8I6ARL0	0.0	999	522	0.937	0.939	A0A8I6ARL0_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=3 SV=1
4	A0A8I6GJ17	0.0	689	724	0.707	0.511	A0A8I6GJ17_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
5	P24298	0.0	704	496	0.633	0.667	ALAT1_HUMAN Alanine aminotransferase 1 OS=Homo sapiens OX=9606 GN=GPT PE=1 SV=3
6	P25409	0.0	710	496	0.635	0.669	ALAT1_RAT Alanine aminotransferase 1 OS=Rattus norvegicus OX=10116 GN=Gpt PE=1 SV=2
7	Q7KV27	0.0	563	568	0.505	0.465	Q7KV27_DROME alanine transaminase OS=Drosophila melanogaster OX=7227 GN=ALT PE=1 SV=1
8	Q7TP13	0.0	689	789	0.702	0.465	Q7TP13_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
9	Q8BGT5	0.0	990	522	0.929	0.931	ALAT2_MOUSE Alanine aminotransferase 2 OS=Mus musculus OX=10090 GN=Gpt2 PE=1 SV=1
10	Q8QZR5	0.0	723	496	0.633	0.667	ALAT1_MOUSE Alanine aminotransferase 1 OS=Mus musculus OX=10090 GN=Gpt PE=1 SV=3
11	Q8T9D5	0.0	563	568	0.505	0.465	Q8T9D5_DROME alanine transaminase OS=Drosophila melanogaster OX=7227 GN=CG1640 PE=2 SV=1
12	Q8TD30	0.0	1086	523	1.000	1.000	ALAT2_HUMAN Alanine aminotransferase 2 OS=Homo sapiens OX=9606 GN=GPT2 PE=1 SV=1
13	Q9VYD9	0.0	563	575	0.505	0.459	Q9VYD9_DROME alanine transaminase OS=Drosophila melanogaster OX=7227 GN=ALT PE=1 SV=3
14	Q9LDV4	3.22e-151	445	540	0.423	0.409	ALAT2_ARATH Alanine aminotransferase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALAAT2 PE=1 SV=1
15	Q9LR30	1.55e-148	436	481	0.423	0.459	GGT1_ARATH Glutamate--glyoxylate aminotransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GGAT1 PE=1 SV=1
16	P52892	6.42e-147	433	507	0.436	0.450	ALAT_YEAST Probable alanine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALT2 PE=1 SV=1
17	Q9S7E9	2.15e-146	431	481	0.419	0.455	GGT2_ARATH Glutamate--glyoxylate aminotransferase 2 OS=Arabidopsis thaliana OX=3702 GN=GGAT2 PE=1 SV=1
18	F4I7I0	1.32e-143	426	543	0.421	0.405	ALAT1_ARATH Alanine aminotransferase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALAAT1 PE=1 SV=1
19	P52893	1.12e-142	425	592	0.432	0.382	ALAM_YEAST Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALT1 PE=1 SV=1
20	Q4GYI2	9.48e-127	383	569	0.396	0.364	Q4GYI2_TRYB2 alanine transaminase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3950 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	1.1e-27	108.8	Aminotransferase class I and II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345282

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359539	0.982	Aspartate aminotransferase, cytoplasmic
2	9606.ENSP00000277865	0.970	Glutamate dehydrogenase 1, mitochondrial
3	9606.ENSP00000245206	0.967	Aspartate aminotransferase, mitochondrial
4	9606.ENSP00000327589	0.955	Glutamate dehydrogenase 2, mitochondrial
5	9606.ENSP00000231420	0.954	Alanine--glyoxylate aminotransferase 2, mitochondrial
6	9606.ENSP00000355518	0.954	Fumarate hydratase, mitochondrial
7	9606.ENSP00000302620	0.934	Alanine-glyoxylate aminotransferase
8	9606.ENSP00000293404	0.921	N-acetylglutamate synthase, mitochondrial
9	9606.ENSP00000303077	0.903	Putative aspartate aminotransferase, cytoplasmic 2
10	9606.ENSP00000331897	0.896	Isocitrate dehydrogenase [NADP], mitochondrial
11	9606.ENSP00000390265	0.886	Isocitrate dehydrogenase 1, cytosolic
12	9606.ENSP00000244137	0.882	Xaa-Pro dipeptidase
13	9606.ENSP00000358417	0.870	D-3-phosphoglycerate dehydrogenase
14	9606.ENSP00000364649	0.868	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
15	9606.ENSP00000222673	0.858	2-oxoglutarate dehydrogenase, mitochondrial
16	9606.ENSP00000264932	0.856	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
17	9606.ENSP00000229270	0.850	Triosephosphate isomerase 1
18	9606.ENSP00000363216	0.838	2-oxoglutarate dehydrogenase-like, mitochondrial
19	9606.ENSP00000217901	0.837	Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
20	9606.ENSP00000370223	0.833	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008483	0.999	transaminase activity
GO:0005488	0.993	binding
GO:0005515	0.970	protein binding
GO:0004021	0.719	L-alanine:2-oxoglutarate aminotransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009991	0.996	response to extracellular stimulus
GO:0032868	0.996	response to insulin
GO:0006111	0.996	regulation of gluconeogenesis
GO:0071375	0.996	cellular response to peptide hormone stimulus
GO:0010676	0.995	positive regulation of cellular carbohydrate metabolic process
GO:1901654	0.978	response to ketone
GO:0033574	0.967	response to testosterone
GO:0032869	0.955	cellular response to insulin stimulus
GO:0010907	0.949	positive regulation of glucose metabolic process
GO:0071704	0.945	organic substance metabolic process
GO:0044237	0.931	cellular metabolic process
GO:0031667	0.926	response to nutrient levels
GO:0044238	0.925	primary metabolic process
GO:0042594	0.895	response to starvation
GO:0044281	0.862	small molecule metabolic process
GO:0006807	0.749	nitrogen compound metabolic process
GO:0009891	0.745	positive regulation of biosynthetic process
GO:0031326	0.741	regulation of cellular biosynthetic process
GO:0031328	0.715	positive regulation of cellular biosynthetic process
GO:0019752	0.639	carboxylic acid metabolic process
GO:1901564	0.567	organonitrogen compound metabolic process
GO:0006520	0.406	amino acid metabolic process
GO:0009058	0.362	biosynthetic process
GO:1901605	0.339	alpha-amino acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005576	0.984	extracellular region
GO:0005615	0.955	extracellular space
GO:0070013	0.938	intracellular organelle lumen
GO:0005759	0.766	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.6.1.-	0.999	Transaminases.
RHEA:19453	0.719	2-oxoglutarate + L-alanine = L-glutamate + pyruvate
EC:2.6.1.2	0.719	alanine transaminase.

[back to server]