StarFunc result for job id Q8TD43

User Input

>input (1214 residues)
MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAMEDAFGAAVVTV
WDSDAHTTEKPTDAYGELDFTGAGRKHSNFLRLSDRTDPAAVYSLVTRTWGFRAPNLVVS
VLGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQMASTGG
TKVVAMGVAPWGVVRNRDTLINPKGSFPARYRWRGDPEDGVQFPLDYNYSAFFLVDDGTH
GCLGGENRFRLRLESYISQQKTGVGGTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLL
VAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKEL
LTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQW
RSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPMRLAQLYSAAPSNSLIRNLLDQA
SHSAGTKAPALKGGAAELRPPDVGHVLRMLLGKMCAPRYPSGGAWDPHPGQGFGESMYLL
SDKATSPLSLDAGLGQAPWSDLLLWALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMA
RLEPDAEEAARRKDLAFKFEGMGVDLFGECYRSSEVRAARLLLRRCPLWGDATCLQLAMQ
ADARAFFAQDGVQSLLTQKWWGDMASTTPIWALVLAFFCPPLIYTRLITFRKSEEEPTRE
ELEFDMDSVINGEGPVGTADPAEKTPLGVPRQSGRPGCCGGRCGGRRCLRRWFHFWGAPV
TIFMGNVVSYLLFLLLFSRVLLVDFQPAPPGSLELLLYFWAFTLLCEELRQGLSGGGGSL
ASGGPGPGHASLSQRLRLYLADSWNQCDLVALTCFLLGVGCRLTPGLYHLGRTVLCIDFM
VFTVRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLGVWLVAYGVATEGLLRPRDSDFP
SILRRVFYRPYLQIFGQIPQEDMDVALMEHSNCSSEPGFWAHPPGAQAGTCVSQYANWLV
VLLLVIFLLVANILLVNLLIAMFSYTFGKVQGNSDLYWKAQRYRLIREFHSRPALAPPFI
VISHLRLLLRQLCRRPRSPQPSSPALEHFRVYLSKEAERKLLTWESVHKENFLLARARDK
RESDSERLKRTSQKVDLALKQLGHIREYEQRLKVLEREVQQCSRVLGWVAEALSRSALLP
PGGPPPPDLPGSKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6bqrA	0.672	0.841	0.000	948	0.777	0.995	6bqrA.pdb.gz	Structure of the human TRPM4 ion channel in a lipid nanodisc.
2	AFDB:Q7TN37	0.834	0.835	0.000	1213	0.825	0.825	Q7TN37.pdb.gz	TRPM4_MOUSE Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1
3	AFDB:Q8TD43	1.000	1.000	0.000	1214	1.000	1.000	Q8TD43.pdb.gz	TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens OX=9606 GN=TRPM4 PE=1 SV=1
4	PDB:6bcqB	0.681	0.823	9.352E-102	983	0.700	0.865	6bcqB.pdb.gz	Structures of the calcium-activated, non-selective cation channel TRPM4.
5	PDB:5wp6A	0.655	0.792	9.629E-100	977	0.794	0.987	5wp6A.pdb.gz	Electron cryo-microscopy structure of a human TRPM4 channel.
6	AFDB:I3IS25	0.783	0.756	6.847E-98	1260	0.467	0.450	I3IS25.pdb.gz
7	AFDB:Q9NZQ8	0.786	0.817	9.854E-88	1165	0.431	0.449	Q9NZQ8.pdb.gz	TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens OX=9606 GN=TRPM5 PE=1 SV=1
8	AFDB:F1LMD7	0.705	0.737	1.817E-84	1156	0.427	0.448	F1LMD7.pdb.gz	F1LMD7_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=3
9	AFDB:E9PTA2	0.819	0.668	4.755E-84	1507	0.356	0.287	E9PTA2.pdb.gz	TRPM2_RAT Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3
10	AFDB:A0A0R4IMY7	0.806	0.673	1.060E-82	1470	0.370	0.305	A0A0R4IMY7.pdb.gz	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
11	AFDB:O94759	0.794	0.649	6.181E-81	1503	0.358	0.289	O94759.pdb.gz	TRPM2_HUMAN Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2
12	AFDB:A7T1N0	0.776	0.616	1.926E-77	1551	0.317	0.248	A7T1N0.pdb.gz	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
13	AFDB:U3JD03	0.739	0.801	2.732E-74	1115	0.311	0.339	U3JD03.pdb.gz	U3JD03_FICAL Transient receptor potential cation channel subfamily M member 8 OS=Ficedula albicollis OX=59894 PE=1 SV=2
14	PDB:6puuA	0.726	0.677	2.307E-69	1309	0.335	0.311	6puuA.pdb.gz	Ligand recognition and gating mechanism through three ligand-binding sites of human TRPM2 channel.
15	PDB:6co7A	0.727	0.827	1.556E-63	1061	0.287	0.329	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
16	PDB:6drjA	0.646	0.623	1.854E-60	1266	0.334	0.320	6drjA.pdb.gz	Architecture of the TRPM2 channel and its activation mechanism by ADP-ribose and calcium.
17	PDB:6pkxB	0.652	0.650	3.571E-57	1218	0.329	0.328	6pkxB.pdb.gz	Visualizing structural transitions of ligand-dependent gating of the TRPM2 channel.
18	PDB:6mj2A	0.701	0.642	2.481E-55	1337	0.334	0.304	6mj2A.pdb.gz	Structures and gating mechanism of human TRPM2.
19	PDB:6pkvA	0.632	0.700	3.677E-52	1087	0.293	0.328	6pkvA.pdb.gz
20	PDB:7wrbA	0.619	0.788	5.216E-52	930	0.269	0.352	7wrbA.pdb.gz	Structures of a mammalian TRPM8 in closed state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IMY7	0.0	686	1470	0.375	0.310	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
2	A0A455XI77	0.0	867	1156	0.434	0.456	A0A455XI77_RAT Transient receptor potential cation channel subfamily M member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=2 SV=1
3	A0A8I6AG64	0.0	867	1164	0.434	0.453	A0A8I6AG64_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=1
4	A7T1N0	0.0	580	1551	0.320	0.251	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
5	E9PTA2	0.0	668	1507	0.358	0.289	TRPM2_RAT Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3
6	F1LMD7	0.0	867	1187	0.434	0.444	F1LMD7_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=3
7	O94759	0.0	693	1503	0.360	0.291	TRPM2_HUMAN Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2
8	Q7TN37	0.0	1912	1213	0.811	0.812	TRPM4_MOUSE Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1
9	Q7Z2W7	0.0	590	1104	0.315	0.347	TRPM8_HUMAN Transient receptor potential cation channel subfamily M member 8 OS=Homo sapiens OX=9606 GN=TRPM8 PE=1 SV=2
10	Q8R455	0.0	592	1104	0.311	0.341	TRPM8_RAT Transient receptor potential cation channel subfamily M member 8 OS=Rattus norvegicus OX=10116 GN=Trpm8 PE=1 SV=4
11	Q8R4D5	0.0	588	1104	0.308	0.339	TRPM8_MOUSE Transient receptor potential cation channel subfamily M member 8 OS=Mus musculus OX=10090 GN=Trpm8 PE=1 SV=3
12	Q8TD43	0.0	2476	1214	1.000	1.000	TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens OX=9606 GN=TRPM4 PE=1 SV=1
13	Q91YD4	0.0	660	1506	0.357	0.288	TRPM2_MOUSE Transient receptor potential cation channel subfamily M member 2 OS=Mus musculus OX=10090 GN=Trpm2 PE=1 SV=2
14	Q9ESQ5	0.0	1907	1208	0.813	0.817	TRPM4_RAT Transient receptor potential cation channel subfamily M member 4 OS=Rattus norvegicus OX=10116 GN=Trpm4 PE=1 SV=2
15	Q9JJH7	0.0	867	1158	0.436	0.457	TRPM5_MOUSE Transient receptor potential cation channel subfamily M member 5 OS=Mus musculus OX=10090 GN=Trpm5 PE=1 SV=1
16	Q9NZQ8	0.0	883	1165	0.436	0.454	TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens OX=9606 GN=TRPM5 PE=1 SV=1
17	S5TRY1	0.0	1015	1260	0.472	0.455	S5TRY1_DANRE Transient receptor potential cation channel, subfamily M, member 4a OS=Danio rerio OX=7955 GN=TRPM4a PE=2 SV=1
18	U3JD03	0.0	613	1115	0.315	0.343	U3JD03_FICAL Transient receptor potential cation channel subfamily M member 8 OS=Ficedula albicollis OX=59894 PE=1 SV=2
19	Q9HCF6	1.13e-158	519	1732	0.314	0.220	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
20	Q9BX84	1.65e-143	481	2022	0.290	0.174	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00520 Ion_trans	7e-09	46.9	Ion transport protein
2	PF18139 LSDAT_euk	1.7e-50	183.4	SLOG in TRPM
3	PF18171 LSDAT_prok	5.2e-15	66.7	SLOG in TRPM, prokaryote

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252826

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303960	0.989	ATP-binding cassette sub-family C member 8
2	9606.ENSP00000410257	0.884	Sodium channel protein type 5 subunit alpha
3	9606.ENSP00000396915	0.870	Sodium channel subunit beta-1
4	9606.ENSP00000278947	0.857	Sodium channel subunit beta-2
5	9606.ENSP00000376523	0.854	Sodium channel subunit beta-3
6	9606.ENSP00000368966	0.846	Short transient receptor potential channel 3
7	9606.ENSP00000390600	0.832	Sodium channel protein type 10 subunit alpha
8	9606.ENSP00000372654	0.822	Aquaporin-4
9	9606.ENSP00000342222	0.820	Transient receptor potential cation channel subfamily V member 2
10	9606.ENSP00000340913	0.806	Short transient receptor potential channel 6
11	9606.ENSP00000419313	0.799	Short transient receptor potential channel 1
12	9606.ENSP00000406191	0.789	Transient receptor potential cation channel subfamily V member 4
13	9606.ENSP00000300061	0.785	Amiloride-sensitive sodium channel subunit gamma
14	9606.ENSP00000353292	0.785	Amiloride-sensitive sodium channel subunit alpha
15	9606.ENSP00000459962	0.781	Transient receptor potential cation channel, subfamily V, member 1
16	9606.ENSP00000461007	0.781	Transient receptor potential cation channel subfamily V member 1
17	9606.ENSP00000301365	0.779	Transient receptor potential cation channel subfamily V member 3
18	9606.ENSP00000322460	0.776	Sodium channel subunit beta-4
19	9606.ENSP00000221444	0.769	Potassium voltage-gated channel subfamily A member 7
20	9606.ENSP00000396320	0.755	Sodium channel protein type 4 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901702	1.000	salt transmembrane transporter activity
GO:0046873	1.000	metal ion transmembrane transporter activity
GO:0005261	1.000	monoatomic cation channel activity
GO:0005227	1.000	calcium activated cation channel activity
GO:0005515	0.997	protein binding
GO:0005262	0.977	calcium channel activity
GO:0042802	0.913	identical protein binding
GO:0015081	0.899	sodium ion transmembrane transporter activity
GO:0005272	0.862	sodium channel activity
GO:0043167	0.857	ion binding
GO:0043169	0.354	cation binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0065007	0.978	biological regulation
GO:0050789	0.974	regulation of biological process
GO:0006811	0.955	monoatomic ion transport
GO:0006816	0.946	calcium ion transport
GO:0098662	0.945	inorganic cation transmembrane transport
GO:0008016	0.943	regulation of heart contraction
GO:0034220	0.942	monoatomic ion transmembrane transport
GO:0098655	0.908	monoatomic cation transmembrane transport
GO:0050794	0.873	regulation of cellular process
GO:0050896	0.867	response to stimulus
GO:0051259	0.822	protein complex oligomerization
GO:0051262	0.811	protein tetramerization
GO:0032501	0.742	multicellular organismal process
GO:0070588	0.727	calcium ion transmembrane transport
GO:0065008	0.693	regulation of biological quality
GO:0051716	0.673	cellular response to stimulus
GO:0051260	0.603	protein homooligomerization
GO:0002027	0.596	regulation of heart rate
GO:0042391	0.583	regulation of membrane potential
GO:0048518	0.536	positive regulation of biological process
GO:0051289	0.534	protein homotetramerization
GO:0001508	0.465	action potential
GO:0007154	0.448	cell communication
GO:0003008	0.401	system process
GO:0048522	0.388	positive regulation of cellular process
GO:0032879	0.384	regulation of localization
GO:0061337	0.356	cardiac conduction
GO:0051049	0.339	regulation of transport
GO:0086001	0.331	cardiac muscle cell action potential
GO:0023052	0.328	signaling
GO:0042221	0.317	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.735	endomembrane system
GO:0043226	0.433	organelle
GO:0032991	0.416	protein-containing complex
GO:0005622	0.331	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.977	Ca(2+)(in) = Ca(2+)(out)
RHEA:34963	0.899	Na(+)(in) = Na(+)(out)

[back to server]