StarFunc result for job id Q8TD57

User Input

>input (1400 residues)
MGATGRLELTLAAPPHPGPAFQRSKARETQGEEEGSEMQIAKSDSIHHMSHSQGQPELPP
LPASANEEPSGLYQTVMSHSFYPPLMQRTSWTLAAPFKEQHHHRGPSDSIANNYSLMAQD
LKLKDLLKVYQPATISVPRDRTGQGLPSSGNRSSSEPMRKKTKFSSRNKEDSTRIKLAFK
TSIFSPMKKEVKTSLTFPGSRPMSPEQQLDVMLQQEMEMESKEKKPSESDLERYYYYLTN
GIRKDMIAPEEGEVMVRISKLISNTLLTSPFLEPLMVVLVQEKENDYYCSLMKSIVDYIL
MDPMERKRLFIESIPRLFPQRVIRAPVPWHSVYRSAKKWNEEHLHTVNPMMLRLKELWFA
EFRDLRFVRTAEILAGKLPLQPQEFWDVIQKHCLEAHQTLLNKWIPTCAQLFTSRKEHWI
HFAPKSNYDSSRNIEEYFASVASFMSLQLRELVIKSLEDLVSLFMIHKDGNDFKEPYQEM
KFFIPQLIMIKLEVSEPIIVFNPSFDGCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTA
AAADRQCVKAAEPGEPSMHAAATAMAELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQKNQ
VGPCKYLNVYKKYVDLLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITVP
LAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTK
ELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPYQIEDIFDNSRNLLLHKRD
QAEMDLIKRCSEFELRLEGYHRELESFRKREVMTTEEMKHNVEKLNELSKNLNRAFAEFE
LINKEEELLEKEKSTYPLLQAMLKNKVPYEQLWSTAYEFSIKSEEWMNGPLFLLNAEQIA
EEIGNMWRTTYKLIKTLSDVPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQI
SEIVGYEIKPTETTCLSNMLEFGFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTF
SFVKYRDTDTNILCAIDDIQMLLDDHVIKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNL
DAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKSLMSQAVKDNRILVAADQP
RMAEKLQEANFLLEDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLK
KCFEGIAKLEFTDNLEIVGMISSEKETVPFIQKIYPANAKGMVEKWLQQVEQMMLASMRE
VIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQALAENTLLDFLKKSNDQIAQ
IVQLVRGKLSSGARLTLGALTVIDVHARDVVAKLSEDRVSDLNDFQWISQLRYYWVAKDV
QVQIITTEALYGYEYLGNSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8fe	0.324	0.106	2.259E-31	4579	0.146	0.045	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	PDB:7z8gA	0.323	0.156	5.323E-26	3047	0.090	0.041	7z8gA.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
3	PDB:7kzmC	0.322	0.122	1.277E-18	3890	0.161	0.058	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
4	PDB:5nugA	0.189	0.098	7.384E-18	2920	0.081	0.039	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
5	PDB:7mi6A	0.266	0.156	8.840E-17	2419	0.065	0.038	7mi6A.pdb.gz	Targeting allostery in the Dynein motor domain with small molecule inhibitors.
6	PDB:4w8fB	0.256	0.141	1.428E-15	2609	0.066	0.035	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
7	PDB:7mi8A	0.162	0.259	1.964E-8	868	0.039	0.063	7mi8A.pdb.gz
8	AFDB:Q7KRW8	0.045	0.055	8.753E-3	1066	0.082	0.108	Q7KRW8.pdb.gz	PRP39_DROME Pre-mRNA-processing factor 39 OS=Drosophila melanogaster OX=7227 GN=Prp39 PE=1 SV=1
9	AFDB:P25644	0.047	0.070	2.060E-2	796	0.068	0.119	P25644.pdb.gz	PAT1_YEAST DNA topoisomerase 2-associated protein PAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAT1 PE=1 SV=4
10	AFDB:Q7PLI2	0.073	0.058	2.902E-2	2077	0.124	0.084	Q7PLI2.pdb.gz	NIPB_DROME Nipped-B protein OS=Drosophila melanogaster OX=7227 GN=Nipped-B PE=1 SV=3
11	PDB:7k1jA	0.049	0.032	3.460E-2	3584	0.104	0.041	7k1jA.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
12	AFDB:M0R4F8	0.049	0.046	5.515E-2	1577	0.089	0.079	M0R4F8.pdb.gz	DNMBP_RAT Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2
13	AFDB:Q8I6Z7	0.063	0.073	6.270E-2	1139	0.086	0.105	Q8I6Z7.pdb.gz	PDEB_PLAF7 Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PDEbeta PE=1 SV=1
14	AFDB:Q62036	0.033	0.043	6.831E-2	1060	0.125	0.165	Q62036.pdb.gz	CP131_MOUSE Centrosomal protein of 131 kDa OS=Mus musculus OX=10090 GN=Cep131 PE=1 SV=2
15	AFDB:Q5XIX0	0.044	0.073	9.620E-2	703	0.073	0.145	Q5XIX0.pdb.gz	DJC14_RAT DnaJ homolog subfamily C member 14 OS=Rattus norvegicus OX=10116 GN=Dnajc14 PE=1 SV=1
16	AFDB:Q58CJ5	0.035	0.050	1.094E-1	899	0.080	0.125	Q58CJ5.pdb.gz	Q58CJ5_DROME GH01093p OS=Drosophila melanogaster OX=7227 GN=sals PE=1 SV=1
17	AFDB:Q5N7C7	0.038	0.074	2.467E-1	539	0.041	0.106	Q5N7C7.pdb.gz	LG2_ORYSJ Transcription factor LG2 OS=Oryza sativa subsp. japonica OX=39947 GN=LG2 PE=1 SV=1
18	PDB:7qpgW	0.102	0.160	2.818E-1	779	0.066	0.118	7qpgW.pdb.gz
19	PDB:7tyrA	0.064	0.032	2.818E-1	3905	0.079	0.028	7tyrA.pdb.gz
20	AFDB:A6XLD8	0.057	0.066	3.626E-1	1105	0.091	0.115	A6XLD8.pdb.gz	A6XLD8_DANRE Sterol regulatory element binding transcription factor 1 OS=Danio rerio OX=7955 GN=SREBF1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WXX0	0.0	764	4024	0.330	0.115	DYH7_HUMAN Dynein axonemal heavy chain 7 OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2
2	Q9VZ77	6.73e-179	594	4385	0.241	0.077	Q9VZ77_DROME Dynein, axonemal, heavy chain 3, isoform D OS=Drosophila melanogaster OX=7227 GN=Dnah3 PE=3 SV=3
3	Q9VJC6	2.92e-178	592	4024	0.274	0.095	Q9VJC6_DROME Dynein heavy chain at 36C, isoform B OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=2
4	A0A6H2EJG3	4.43e-178	592	4065	0.274	0.094	A0A6H2EJG3_DROME Dynein heavy chain at 36C, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=1
5	Q4AC22	2.21e-164	551	4149	0.295	0.100	Q4AC22_CHLRE Dynein heavy chain 9 OS=Chlamydomonas reinhardtii OX=3055 GN=DHC9 PE=1 SV=3
6	Q9P2D7	4.80e-154	520	4265	0.219	0.072	DYH1_HUMAN Dynein axonemal heavy chain 1 OS=Homo sapiens OX=9606 GN=DNAH1 PE=1 SV=6
7	E9Q8T7	4.28e-152	514	4250	0.214	0.070	DYH1_MOUSE Dynein axonemal heavy chain 1 OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1
8	Q7KVA7	7.20e-128	442	3964	0.203	0.072	Q7KVA7_DROME Dynein heavy chain at 62B OS=Drosophila melanogaster OX=7227 GN=Dhc62B PE=3 SV=2
9	Q38B68	4.26e-113	397	4142	0.183	0.062	Q38B68_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1720 PE=4 SV=1
10	Q384K3	3.51e-110	389	4152	0.208	0.070	Q384K3_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0390 PE=4 SV=1
11	Q585U4	5.73e-106	375	4246	0.189	0.062	Q585U4_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.85 PE=4 SV=1
12	Q9P225	3.82e-96	345	4427	0.176	0.056	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
13	Q57VT8	1.23e-95	343	4112	0.145	0.049	Q57VT8_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.29K4.310 PE=4 SV=1
14	E9Q0B6	6.00e-92	332	4144	0.139	0.047	E9Q0B6_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
15	P0C6F1	6.69e-91	329	4456	0.156	0.049	DYH2_MOUSE Dynein axonemal heavy chain 2 OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1
16	E9Q3H7	3.62e-82	301	4092	0.129	0.044	E9Q3H7_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
17	D3YYQ8	8.90e-81	297	4591	0.159	0.048	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
18	F7ABZ6	1.20e-80	297	4534	0.159	0.049	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
19	E9Q7N9	9.25e-78	288	4488	0.131	0.041	E9Q7N9_MOUSE Dynein, axonemal, heavy chain 11 OS=Mus musculus OX=10090 GN=Dnah11 PE=1 SV=2
20	Q9QZH1	9.25e-78	288	4488	0.131	0.041	Q9QZH1_MOUSE Left-right dynein OS=Mus musculus OX=10090 GN=Dnah11 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11527 ARL2_Bind_BART	3.4e+02	12.7	The ARF-like 2 binding protein BART
2	PF08393 DHC_N2	1.3e-140	480.6	Dynein heavy chain, N-terminal region 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261383

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380378	0.939	Platelet-activating factor acetylhydrolase IB subunit alpha
2	9606.ENSP00000354791	0.936	Dynactin subunit 1
3	9606.ENSP00000479322	0.933	CAP-Gly domain-containing linker protein 1
4	9606.ENSP00000408910	0.927	Dynactin subunit 2
5	9606.ENSP00000401514	0.919	Dynein heavy chain 1, axonemal
6	9606.ENSP00000333363	0.918	Dynein heavy chain 8, axonemal
7	9606.ENSP00000265104	0.917	Dynein heavy chain 5, axonemal
8	9606.ENSP00000374045	0.913	Dynein heavy chain 6, axonemal
9	9606.ENSP00000259632	0.908	Dynactin subunit 3
10	9606.ENSP00000221114	0.900	Dynactin subunit 6
11	9606.ENSP00000480538	0.832	Dynein intermediate chain 1, axonemal
12	9606.ENSP00000289228	0.824	Beta-centractin
13	9606.ENSP00000358921	0.824	Alpha-centractin
14	9606.ENSP00000254286	0.820	Actin related protein 10 homolog
15	9606.ENSP00000414906	0.807	Dynactin subunit 4
16	9606.ENSP00000300087	0.801	Dynactin subunit 5
17	9606.ENSP00000334002	0.800	Huntingtin-associated protein 1
18	9606.ENSP00000400252	0.787	Dynein intermediate chain 2, axonemal
19	9606.ENSP00000452037	0.775	Dynein light chain 1, axonemal
20	9606.ENSP00000310829	0.731	Cilia- and flagella-associated protein 70

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003777	1.000	microtubule motor activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0003341	0.988	cilium movement
GO:0060285	0.812	cilium-dependent cell motility
GO:0060294	0.744	cilium movement involved in cell motility
GO:0097722	0.730	sperm motility
GO:0030317	0.697	flagellated sperm motility

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.998	cilium
GO:0005622	0.996	intracellular anatomical structure
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0005737	0.989	cytoplasm
GO:0005856	0.964	cytoskeleton
GO:0032991	0.917	protein-containing complex
GO:0031514	0.819	motile cilium
GO:0036126	0.804	sperm flagellum
GO:0015630	0.802	microtubule cytoskeleton
GO:0005875	0.738	microtubule associated complex
GO:0030286	0.611	dynein complex
GO:0097014	0.508	ciliary plasm
GO:0043231	0.473	intracellular membrane-bounded organelle
GO:0016020	0.437	membrane
GO:0005829	0.425	cytosol
GO:0005930	0.424	axoneme
GO:0012505	0.423	endomembrane system
GO:0070013	0.423	intracellular organelle lumen
GO:0005815	0.386	microtubule organizing center
GO:0005813	0.384	centrosome
GO:0005874	0.381	microtubule
GO:0005868	0.381	cytoplasmic dynein complex
GO:0035578	0.381	azurophil granule lumen
GO:0005576	0.378	extracellular region
GO:0070062	0.369	extracellular exosome
GO:0005858	0.364	axonemal dynein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]