StarFunc result for job id Q8TD84

User Input

>input (2053 residues)
MWLVTFLLLLDSLHKARPEDVGTSLYFVNDSLQQVTFSSSVGVVVPCPAAGSPSAALRWY
LATGDDIYDVPHIRHVHANGTLQLYPFSPSAFNSFIHDNDYFCTAENAAGKIRSPNIRVK
AVFREPYTVRVEDQRSMRGNVAVFKCLIPSSVQEYVSVVSWEKDTVSIIPEHRFFITYHG
GLYISDVQKEDALSTYRCITKHKYSGETRQSNGARLSVTDPAESIPTILDGFHSQEVWAG
HTVELPCTASGYPIPAIRWLKDGRPLPADSRWTKRITGLTISDLRTEDSGTYICEVTNTF
GSAEATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWYRNTELVLPDEA
ISIRGLSNETLLITSAQKSHSGAYQCFATRKAQTAQDFAIIALEDGTPRIVSSFSEKVVN
PGEQFSLMCAAKGAPPPTVTWALDDEPIVRDGSHRTNQYTMSDGTTISHMNVTGPQIRDG
GVYRCTARNLVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYK
DALLLPDNHRQVVFENGTLKLTDVQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQ
PFEFPPASIGQLLYIPCVVSSGDMPIRITWRKDGQVIISGSGVTIESKEFMSSLQISSVS
LKHNGNYTCIASNAAATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPK
VMWKHAKGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTDISKS
MFLTVKIPAMITSHPNTTIAIKGHAKELNCTARGERPIIIRWEKGDTVIDPDRVMRYAIA
TKDNGDEVVSTLKLKPADRGDSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELEIREVKA
RSMNLRWTQRFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQANIVDLHPASVYSI
RMYSFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIR
GYQIGYRENSPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSE
INATTLEDVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYRVIFWSLYVDGEWG
EMQNITTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTKEDVPGPPAGIKAV
PSSASSVVVSWLPPTKPNGVIRKYTIFCSSPGSGQPAPSEYETSPEQLFYRIAHLNRGQQ
YLLWVAAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRLPCNSVGDPAPA
VKWTKDSEDSAIPVSMDGHRLIHTNGTLLLRAVKAEDSGYYTCTATNTGGFDTIIVNLLV
QVPPDQPRLTVSKTSASSITLTWIPGDNGGSSIRGFVLQYSVDNSEEWKDVFISSSERSF
KLDSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGREPSFSKDQHLFTHINSTHARLNL
QGWNNGGCPITAIVLEYRPKGTWAWQGLRANSSGEVFLTELREATWYELRMRACNSAGCG
NETAQFATLDYDGSTIPPIKSAQGEGDDVKKLFTIGCPVILATLGVALLFIVRKKRKEKR
LKRLRDAKSLAEMLISKNNRSFDTPVKGPPQGPRLHIDIPRVQLLIEDKEGIKQLGDDKA
TIPVTDAEFSQAVNPQSFCTGVSLHHPTLIQSTGPLIDMSDIRPGTNPVSRKNVKSAHST
RNRYSSQWTLTKCQASTPARTLTSDWRTVGSQHGVTVTESDSYSASLSQDTDKGRNSMVS
TESASSTYEELARAYEHAKLEEQLQHAKFEITECFISDSSSDQMTTGTNENADSMTSMST
PSEPGICRFTASPPKPQDADRGKNVAVPIPHRANKSDYCNLPLYAKSEAFFRKADGREPC
PVVPPREASIRNLARTYHTQARHLTLDPASKSLGLPHPGAPAAASTATLPQRTLAMPAPP
AGTAPPAPGPTPAEPPTAPSAAPPAPSTEPPRAGGPHTKMGGSRDSLLEMSTSGVGRSQK
QGAGAYSKSYTLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4K6Z6	0.354	0.356	0.000	2037	0.288	0.290	A0A0B4K6Z6.pdb.gz	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
2	AFDB:A0A2R8QL08	0.381	0.384	0.000	2036	0.550	0.555	A0A2R8QL08.pdb.gz
3	AFDB:F1NY98	0.502	0.506	0.000	2034	0.596	0.601	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
4	AFDB:Q4VA61	0.611	0.611	0.000	2053	0.981	0.981	Q4VA61.pdb.gz	DSCL1_MOUSE Cell adhesion molecule DSCAML1 OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 SV=2
5	AFDB:Q6WRH9	0.087	0.072	1.091E-39	2597	0.115	0.091	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
6	AFDB:M9NE05	0.083	0.079	9.625E-37	2192	0.138	0.130	M9NE05.pdb.gz	M9NE05_DROME Neuromusculin, isoform E OS=Drosophila melanogaster OX=7227 GN=nrm PE=4 SV=1
7	PDB:5oj2B	0.088	0.225	7.621E-28	692	0.067	0.198	5oj2B.pdb.gz
8	PDB:1e07A	0.090	0.209	9.307E-20	642	0.057	0.182	1e07A.pdb.gz
9	PDB:7sqcO0	0.088	0.145	1.212E-16	1140	0.046	0.083	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
10	PDB:5a42A	0.054	0.065	8.360E-15	1597	0.053	0.068	5a42A.pdb.gz
11	AFDB:P09208	0.063	0.061	1.118E-14	2144	0.084	0.081	P09208.pdb.gz	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
12	PDB:7q5zA	0.074	0.095	5.358E-14	1344	0.041	0.062	7q5zA.pdb.gz
13	PDB:7q1yA	0.062	0.084	1.386E-13	1374	0.050	0.074	7q1yA.pdb.gz
14	PDB:6h03A	0.070	0.094	1.447E-13	1223	0.037	0.062	6h03A.pdb.gz
15	PDB:8dtlA	0.113	0.276	4.450E-13	741	0.029	0.081	8dtlA.pdb.gz
16	PDB:7nycA	0.096	0.116	1.151E-12	1542	0.041	0.054	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
17	PDB:6pxvA	0.114	0.254	1.311E-12	823	0.030	0.074	6pxvA.pdb.gz
18	AFDB:E9Q4Y4	0.062	0.053	2.364E-5	2514	0.051	0.042	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
19	AFDB:O60336	0.035	0.037	4.803E-3	1514	0.077	0.105	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
20	AFDB:O43379	0.041	0.048	9.183E-3	1518	0.084	0.113	O43379.pdb.gz	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K6Q9	919	2035	0.259	0.261	A0A0B4K6Q9_DROME Down syndrome cell adhesion molecule 1, isoform CA (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
2	A0A0B4K6R4	939	2035	0.260	0.262	A0A0B4K6R4_DROME Down syndrome cell adhesion molecule 1, isoform BK OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
3	A0A0B4K6R8	912	2019	0.256	0.260	A0A0B4K6R8_DROME Down syndrome cell adhesion molecule 1, isoform BP OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
4	A0A0B4K6S2	931	2036	0.259	0.261	A0A0B4K6S2_DROME Down syndrome cell adhesion molecule 1, isoform BV OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
5	A0A0B4K6Y9	912	2020	0.257	0.261	A0A0B4K6Y9_DROME Down syndrome cell adhesion molecule 1, isoform CB (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
6	A0A0B4K6Z3	936	2019	0.259	0.263	A0A0B4K6Z3_DROME Down syndrome cell adhesion molecule 1, isoform BL OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
7	A0A0B4K6Z6	902	2037	0.256	0.258	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
8	A0A0B4K6Z8	926	2016	0.259	0.264	A0A0B4K6Z8_DROME Down syndrome cell adhesion molecule 1, isoform BW OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
9	A0A0B4K7H7	905	2020	0.256	0.260	A0A0B4K7H7_DROME Down syndrome cell adhesion molecule 1, isoform BY (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
10	A0A0B4K7H9	921	2030	0.258	0.261	A0A0B4K7H9_DROME Down syndrome cell adhesion molecule 1, isoform BI OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
11	A0A0B4K7I3	927	2036	0.258	0.260	A0A0B4K7I3_DROME Down syndrome cell adhesion molecule 1, isoform BN OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
12	A0A0B4K7I5	926	2016	0.259	0.263	A0A0B4K7I5_DROME Down syndrome cell adhesion molecule 1, isoform BT OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
13	A0A0B4K7T4	910	2035	0.256	0.258	A0A0B4K7T4_DROME Down syndrome cell adhesion molecule 1, isoform BZ (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
14	A0A0B4K7T5	913	2033	0.256	0.258	A0A0B4K7T5_DROME Down syndrome cell adhesion molecule 1, isoform BJ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
15	A0A0B4K7T6	920	2019	0.255	0.259	A0A0B4K7T6_DROME Down syndrome cell adhesion molecule 1, isoform BO OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
16	A0A0B4K7T8	924	2034	0.258	0.260	A0A0B4K7T8_DROME Down syndrome cell adhesion molecule 1, isoform BU OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
17	A0A0B4K823	914	2038	0.257	0.259	A0A0B4K823_DROME Down syndrome cell adhesion molecule 1, isoform BX (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
18	A0A0B4K824	921	2035	0.258	0.260	A0A0B4K824_DROME Down syndrome cell adhesion molecule 1, isoform CC (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
19	A0A0B4K827	927	2028	0.256	0.259	A0A0B4K827_DROME Down syndrome cell adhesion molecule 1, isoform BM OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
20	A0A0B4K828	934	2032	0.260	0.262	A0A0B4K828_DROME Down syndrome cell adhesion molecule 1, isoform BR OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2.9e-09	48.5	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	6.5e-17	72.7	CD80-like C2-set immunoglobulin domain
3	PF08329 ChitinaseA_N	1.5e+02	13.5	Chitinase A, N-terminal domain
4	PF00041 fn3	2.2e-77	266.8	Fibronectin type III domain
5	PF16893 fn3_2	0.11	24.0	Fibronectin type III domain
6	PF16794 fn3_4	2.9e+02	12.8	Fibronectin-III type domain
7	PF07679 I-set	3.8e-108	365.1	Immunoglobulin I-set domain
8	PF00047 ig	5.2e-68	236.6	Immunoglobulin domain
9	PF13895 Ig_2	8.6e-74	255.2	Immunoglobulin domain
10	PF13927 Ig_3	2.5e-106	359.7	Immunoglobulin domain
11	PF16680 Ig_4	1.8e-05	36.6	T-cell surface glycoprotein CD3 delta chain
12	PF18452 Ig_6	3.4e-07	41.6	Immunoglobulin domain
13	PF09294 Interfer-bind	0.0016	30.1	Interferon-alpha/beta receptor, fibronectin type III
14	PF16706 Izumo-Ig	0.17	23.2	Izumo-like Immunoglobulin domain
15	PF16656 Pur_ac_phosph_N	0.00012	34.0	Purple acid Phosphatase, N-terminal domain
16	PF11465 Receptor_2B4	0.00025	32.6	Natural killer cell receptor 2B4
17	PF07686 V-set	2e-26	103.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315465

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000173229	0.787	Netrin-1
2	9606.ENSP00000335614	0.718	Liprin-alpha-3
3	9606.ENSP00000445002	0.650	Apolipoprotein A-V
4	9606.ENSP00000270235	0.624	Plays a role in neurogenesis. Prevents motor neuron cell body migration out of the neural tube
5	9606.ENSP00000278568	0.580	Serine/threonine-protein kinase PAK 1
6	9606.ENSP00000233154	0.572	Cytoplasmic protein NCK2
7	9606.ENSP00000316909	0.567	Vesicular glutamate transporter 3
8	9606.ENSP00000356236	0.556	Synaptotagmin-2
9	9606.ENSP00000210633	0.553	Semaphorin-4G
10	9606.ENSP00000417273	0.546	Cytoplasmic protein NCK1
11	9606.ENSP00000357402	0.544	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2
12	9606.ENSP00000011292	0.539	Carboxypeptidase A1
13	9606.ENSP00000350425	0.538	Apolipoprotein A-IV
14	9606.ENSP00000225964	0.535	Collagen alpha-1(I) chain
15	9606.ENSP00000355192	0.528	Voltage-dependent L-type calcium channel subunit alpha-1S
16	9606.ENSP00000347719	0.513	Tubulin-specific chaperone D
17	9606.ENSP00000266058	0.503	Slit homolog 1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding
GO:0046983	0.918	protein dimerization activity
GO:0042803	0.907	protein homodimerization activity
GO:0038023	0.724	signaling receptor activity
GO:0008046	0.601	axon guidance receptor activity
GO:0003823	0.563	antigen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0032501	0.990	multicellular organismal process
GO:0032502	0.989	developmental process
GO:0048856	0.979	anatomical structure development
GO:0007275	0.963	multicellular organism development
GO:0050794	0.916	regulation of cellular process
GO:0007155	0.877	cell adhesion
GO:0048731	0.816	system development
GO:0007399	0.797	nervous system development
GO:0071840	0.692	cellular component organization or biogenesis
GO:0016043	0.675	cellular component organization
GO:0009653	0.491	anatomical structure morphogenesis
GO:0051128	0.409	regulation of cellular component organization
GO:0048513	0.405	animal organ development
GO:0050896	0.380	response to stimulus
GO:0048518	0.358	positive regulation of biological process
GO:0048519	0.357	negative regulation of biological process
GO:0048523	0.351	negative regulation of cellular process
GO:0048869	0.328	cellular developmental process
GO:0098609	0.326	cell-cell adhesion
GO:0030154	0.322	cell differentiation
GO:0098742	0.303	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0048522	0.301	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005886	0.993	plasma membrane
GO:0030054	0.970	cell junction
GO:0045202	0.888	synapse
GO:0005576	0.836	extracellular region
GO:0043226	0.675	organelle
GO:0042995	0.481	cell projection
GO:0005615	0.395	extracellular space
GO:0120025	0.343	plasma membrane bounded cell projection
GO:0005737	0.337	cytoplasm
GO:0043229	0.314	intracellular organelle
GO:0043005	0.313	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]