StarFunc result for job id Q8TD94

User Input

>input (323 residues)
MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAPPESALPGPGPPGP
ASVPQLPQVPAPSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRASSGFSDPIPC
SVQTPCSELAPASGAAAVCAPESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAAD
QAPRRRSVTPAAKRHQCPFPGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSD
ELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRIDPPL
TSEVESSASGSGPGPAPSFTTCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TD94	1.000	1.000	4.099E-50	323	1.000	1.000	Q8TD94.pdb.gz	KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens OX=9606 GN=KLF14 PE=2 SV=2
2	AFDB:Q9JJZ6	0.290	0.322	2.426E-16	289	0.421	0.471	Q9JJZ6.pdb.gz	KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus OX=10090 GN=Klf13 PE=1 SV=2
3	AFDB:P46099	0.289	0.264	3.218E-13	358	0.316	0.285	P46099.pdb.gz	KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus OX=10090 GN=Klf1 PE=1 SV=2
4	AFDB:P57682	0.290	0.272	1.067E-12	345	0.245	0.229	P57682.pdb.gz	KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens OX=9606 GN=KLF3 PE=1 SV=1
5	AFDB:R9PY21	0.264	0.120	5.635E-12	720	0.325	0.146	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
6	AFDB:A2BG67	0.274	0.270	1.635E-11	328	0.260	0.256	A2BG67.pdb.gz	A2BG67_DANRE Krueppel-like factor 3 OS=Danio rerio OX=7955 GN=klf12 PE=4 SV=1
7	AFDB:Q1LXI7	0.275	0.237	1.868E-11	380	0.229	0.195	Q1LXI7.pdb.gz	Q1LXI7_DANRE Krueppel-like factor 2 OS=Danio rerio OX=7955 GN=etID35223.22 PE=4 SV=1
8	AFDB:O35738	0.296	0.244	3.401E-11	402	0.285	0.229	O35738.pdb.gz	KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus OX=10090 GN=Klf12 PE=1 SV=2
9	AFDB:D3ZT88	0.257	0.222	4.153E-11	376	0.279	0.239	D3ZT88.pdb.gz	D3ZT88_RAT Sp6 transcription factor OS=Rattus norvegicus OX=10116 GN=Sp6 PE=4 SV=1
10	AFDB:Q1JPX0	0.264	0.239	2.053E-10	357	0.288	0.261	Q1JPX0.pdb.gz
11	PDB:7oniH	0.072	0.064	3.121	380	0.056	0.047	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
12	PDB:6ydhA	0.057	0.206	3.811	62	0.031	0.161	6ydhA.pdb.gz
13	PDB:7o4iW	0.061	0.063	4.654	312	0.062	0.064	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:7r7jB	0.044	0.030	4.974	574	0.025	0.014	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
15	PDB:7od1A	0.072	0.060	5.683	430	0.056	0.042	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:6ff47	0.073	0.206	6.074	93	0.050	0.172	6ff47.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:4aybB	0.074	0.028	7.927	1103	0.025	0.007	4aybB.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
18	PDB:5aj0Ap	0.074	0.156	8.473	91	0.040	0.143	5aj0Ap.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
19	PDB:5gm6I	0.067	0.170	8.473	102	0.025	0.078	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:4kblA	0.063	0.054	9.056	395	0.043	0.035	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TD94	0.0	634	323	1.000	1.000	KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens OX=9606 GN=KLF14 PE=2 SV=2
2	Q19A41	4.39e-114	335	325	0.594	0.591	KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus OX=10090 GN=Klf14 PE=2 SV=1
3	Q9BXK1	8.54e-52	173	252	0.241	0.310	KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens OX=9606 GN=KLF16 PE=1 SV=1
4	P58334	9.00e-51	170	251	0.238	0.307	KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus OX=10090 GN=Klf16 PE=1 SV=2
5	O35739	1.07e-48	165	244	0.365	0.484	KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus OX=10090 GN=Klf9 PE=2 SV=1
6	Q01713	1.10e-48	165	244	0.365	0.484	KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus OX=10116 GN=Klf9 PE=2 SV=1
7	Q9Y2Y9	1.37e-48	166	288	0.214	0.240	KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens OX=9606 GN=KLF13 PE=1 SV=1
8	Q9JJZ6	6.41e-48	164	289	0.211	0.235	KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus OX=10090 GN=Klf13 PE=1 SV=2
9	Q13886	2.57e-46	159	244	0.362	0.480	KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens OX=9606 GN=KLF9 PE=1 SV=1
10	A8E7A9	2.90e-45	156	250	0.214	0.276	A8E7A9_DANRE Krueppel-like factor 16 OS=Danio rerio OX=7955 GN=wu:fi22b08 PE=4 SV=1
11	A2BGS7	1.51e-44	153	216	0.229	0.343	A2BGS7_DANRE Krueppel-like factor 9 OS=Danio rerio OX=7955 GN=si:dkey-201c13.3 PE=2 SV=1
12	Q309C9	6.36e-40	148	501	0.241	0.156	Q309C9_RAT Kruppel-like factor 11 OS=Rattus norvegicus OX=10116 GN=Klf11 PE=2 SV=1
13	E9PTS6	6.56e-40	148	501	0.241	0.156	E9PTS6_RAT Kruppel-like factor 11 OS=Rattus norvegicus OX=10116 GN=Klf11 PE=4 SV=1
14	Q8K1S5	6.79e-40	148	502	0.207	0.133	KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus OX=10090 GN=Klf11 PE=2 SV=3
15	O14901	1.80e-39	147	512	0.204	0.129	KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens OX=9606 GN=KLF11 PE=1 SV=2
16	Q53QU8	1.80e-39	147	512	0.204	0.129	Q53QU8_HUMAN Uncharacterized protein TIEG2 OS=Homo sapiens OX=9606 GN=TIEG2 PE=2 SV=1
17	Q95R58	2.47e-39	143	347	0.173	0.161	Q95R58_DROME SD05726p OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
18	Q8IPV7	2.71e-39	143	347	0.173	0.161	Q8IPV7_DROME Cabut, isoform B OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
19	Q4R0P9	3.26e-39	145	428	0.173	0.131	Q4R0P9_DROME Cabut OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
20	Q9VPQ5	4.23e-39	144	428	0.173	0.131	Q9VPQ5_DROME Cabut, isoform A OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	73	15.3	FOXP coiled-coil domain
2	PF00096 zf-C2H2	3.4e-13	60.4	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	0.00028	32.4	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	4.6e+02	12.3	C2H2-type zinc finger
5	PF15909 zf-C2H2_8	2e+02	13.7	C2H2-type zinc ribbon
6	PF12171 zf-C2H2_jaz	2.3e+02	13.4	Zinc-finger double-stranded RNA-binding
7	PF13465 zf-H2C2_2	4.4e-10	50.7	Zinc-finger double domain
8	PF12874 zf-met	3.2e+02	13.1	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000463287

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.692	Histone acetyltransferase p300
2	9606.ENSP00000285518	0.655	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
3	9606.ENSP00000316476	0.648	Sphingolipid delta(4)-desaturase DES1
4	9606.ENSP00000324248	0.616	Proenkephalin-A
5	9606.ENSP00000346693	0.604	Elongation of very long chain fatty acids protein 2
6	9606.ENSP00000318085	0.584	Histone H4 transcription factor
7	9606.ENSP00000261749	0.576	AN1-type zinc finger protein 6
8	9606.ENSP00000311219	0.575	Tripartite motif-containing protein 59
9	9606.ENSP00000423390	0.571	Ubiquitin carboxyl-terminal hydrolase 26
10	9606.ENSP00000377233	0.565	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
11	9606.ENSP00000255198	0.562	Zinc finger BED domain-containing protein 3
12	9606.ENSP00000257068	0.560	Melatonin receptor type 1B
13	9606.ENSP00000359956	0.559	Elongation of very long chain fatty acids protein 5
14	9606.ENSP00000406718	0.558	Uncharacterized protein LOC101928448
15	9606.ENSP00000358404	0.554	Transcription factor 7-like 2
16	9606.ENSP00000334294	0.552	Transcription factor-like 5 protein
17	9606.ENSP00000381968	0.551	Serine palmitoyltransferase 3
18	9606.ENSP00000386665	0.540	Four and a half LIM domains protein 2
19	9606.ENSP00000155840	0.525	Potassium voltage-gated channel subfamily KQT member 1
20	9606.ENSP00000274695	0.520	Threonylcarbamoyladenosine tRNA methylthiotransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.994	protein binding
GO:0140110	0.675	transcription regulator activity
GO:0000976	0.522	transcription cis-regulatory region binding
GO:0000977	0.334	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.977	regulation of cellular process
GO:0045944	0.814	positive regulation of transcription by RNA polymerase II
GO:0009987	0.667	cellular process
GO:0050896	0.364	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.988	nucleoplasm
GO:0005737	0.932	cytoplasm
GO:0005829	0.342	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]