StarFunc result for job id Q8TDB6

User Input

>input (740 residues)
MASHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSE
RAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAETPSGDMHQHE
GHIPNAVDSCLQKIFLTVTADLNCNLFSKEQRAYITTLCPSIRKMEGHDGIEKVCGDFQD
IERIHQFLSEQFLESEQKQQFSPSMTERKPLSQQERDSCISPSEPETKAEQKSNYFEVPL
PYFEYFKYICPDKINSIEKRFGVNIEIQESSPNMVCLDFTSSRSGDLEAARESFASEFQK
NTEPLKQECVSLADSKQANKFKQELNHQFTKLLIKEKGGELTLLGTQDDISAAKQKISEA
FVKIPVKLFAANYMMNVIEVDSAHYKLLETELLQEISEIEKRYDICSKVSEKGQKTCILF
ESKDRQVDLSVHAYASFIDAFQHASCQLMREVLLLKSLGKERKHLHQTKFADDFRKRHPN
VHFVLNQESMTLTGLPNHLAKAKQYVLKGGGMSSLAGKKLKEGHETPMDIDSDDSKAASP
PLKGSVSSEASELDKKEKGICVICMDTISNKKVLPKCKHEFCAPCINKAMSYKPICPTCQ
TSYGIQKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQR
TAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYG
YPDPSYLKRVKEELKAKGIE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDB6	1.000	1.000	0.000	740	1.000	1.000	Q8TDB6.pdb.gz	DTX3L_HUMAN E3 ubiquitin-protein ligase DTX3L OS=Homo sapiens OX=9606 GN=DTX3L PE=1 SV=1
2	AFDB:Q80V91	0.241	0.494	1.292E-30	347	0.162	0.346	Q80V91.pdb.gz	DTX3_MOUSE Probable E3 ubiquitin-protein ligase DTX3 OS=Mus musculus OX=10090 GN=Dtx3 PE=1 SV=2
3	AFDB:Q86UW9	0.237	0.281	6.140E-19	622	0.130	0.154	Q86UW9.pdb.gz	DTX2_HUMAN Probable E3 ubiquitin-protein ligase DTX2 OS=Homo sapiens OX=9606 GN=DTX2 PE=1 SV=3
4	AFDB:Q8R3P2	0.236	0.281	3.835E-18	619	0.124	0.149	Q8R3P2.pdb.gz	DTX2_MOUSE Probable E3 ubiquitin-protein ligase DTX2 OS=Mus musculus OX=10090 GN=Dtx2 PE=1 SV=2
5	AFDB:A0A0U3RBN1	0.235	0.317	4.573E-17	545	0.119	0.161	A0A0U3RBN1.pdb.gz	A0A0U3RBN1_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=dtx1 PE=2 SV=1
6	AFDB:Q9Y2E6	0.235	0.280	3.947E-16	619	0.115	0.137	Q9Y2E6.pdb.gz	DTX4_HUMAN E3 ubiquitin-protein ligase DTX4 OS=Homo sapiens OX=9606 GN=DTX4 PE=1 SV=2
7	AFDB:Q61010	0.234	0.275	6.410E-16	627	0.116	0.137	Q61010.pdb.gz	DTX1_MOUSE E3 ubiquitin-protein ligase DTX1 OS=Mus musculus OX=10090 GN=Dtx1 PE=1 SV=2
8	AFDB:Q2EMV9	0.141	0.071	3.058E-15	1817	0.128	0.052	Q2EMV9.pdb.gz	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
9	AFDB:Q23985	0.227	0.227	3.595E-15	738	0.197	0.198	Q23985.pdb.gz	DTX_DROME Protein deltex OS=Drosophila melanogaster OX=7227 GN=dx PE=1 SV=2
10	AFDB:Q460N5	0.117	0.054	4.062E-14	1801	0.127	0.052	Q460N5.pdb.gz	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
11	PDB:5wq7A	0.118	0.156	1.834E-4	472	0.064	0.100	5wq7A.pdb.gz
12	PDB:5wq8A	0.123	0.155	2.401E-4	496	0.047	0.071	5wq8A.pdb.gz
13	PDB:7ajuJJ	0.104	0.276	2.401E-4	199	0.023	0.085	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7mqaSW	0.098	0.282	5.388E-4	195	0.026	0.097	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7mq8NY	0.089	0.216	2.571E-3	274	0.024	0.066	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:5lsrB	0.078	0.226	6.781E-3	206	0.046	0.165	5lsrB.pdb.gz
17	PDB:5gt8B	0.072	0.152	7.553E-3	270	0.042	0.115	5gt8B.pdb.gz
18	PDB:6wo1B	0.065	0.197	1.227E-2	197	0.041	0.152	6wo1B.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.
19	PDB:4r8pL	0.066	0.180	2.342E-2	254	0.034	0.098	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
20	PDB:6ke6RC	0.098	0.196	2.608E-2	278	0.031	0.083	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TDB6	0.0	1534	740	1.000	1.000	DTX3L_HUMAN E3 ubiquitin-protein ligase DTX3L OS=Homo sapiens OX=9606 GN=DTX3L PE=1 SV=1
2	Q8N9I9	7.16e-65	221	347	0.139	0.297	DTX3_HUMAN Probable E3 ubiquitin-protein ligase DTX3 OS=Homo sapiens OX=9606 GN=DTX3 PE=1 SV=2
3	Q80V91	1.17e-64	220	347	0.139	0.297	DTX3_MOUSE Probable E3 ubiquitin-protein ligase DTX3 OS=Mus musculus OX=10090 GN=Dtx3 PE=1 SV=2
4	A0A0U3RBN1	1.17e-42	165	545	0.122	0.165	A0A0U3RBN1_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=dtx1 PE=2 SV=1
5	E7ET89	2.16e-41	161	531	0.120	0.168	E7ET89_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=DTX2 PE=1 SV=1
6	Q86UW9	5.87e-41	161	622	0.120	0.143	DTX2_HUMAN Probable E3 ubiquitin-protein ligase DTX2 OS=Homo sapiens OX=9606 GN=DTX2 PE=1 SV=3
7	Q61010	2.36e-38	153	627	0.116	0.137	DTX1_MOUSE E3 ubiquitin-protein ligase DTX1 OS=Mus musculus OX=10090 GN=Dtx1 PE=1 SV=2
8	Q8R3P2	2.47e-38	153	619	0.118	0.141	DTX2_MOUSE Probable E3 ubiquitin-protein ligase DTX2 OS=Mus musculus OX=10090 GN=Dtx2 PE=1 SV=2
9	Q9Y2E6	1.55e-37	151	619	0.114	0.136	DTX4_HUMAN E3 ubiquitin-protein ligase DTX4 OS=Homo sapiens OX=9606 GN=DTX4 PE=1 SV=2
10	Q86Y01	2.26e-37	150	620	0.115	0.137	DTX1_HUMAN E3 ubiquitin-protein ligase DTX1 OS=Homo sapiens OX=9606 GN=DTX1 PE=1 SV=1
11	Q23985	2.28e-33	139	738	0.097	0.098	DTX_DROME Protein deltex OS=Drosophila melanogaster OX=7227 GN=dx PE=1 SV=2
12	Q2EMV9	2.34e-06	53.9	1817	0.061	0.025	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
13	Q5ZIP0	3.00e-05	49.7	501	0.026	0.038	Q5ZIP0_CHICK RING-type E3 ubiquitin transferase OS=Gallus gallus OX=9031 GN=RCJMB04_24j13 PE=2 SV=1
14	Q9NS91	1.39e-04	47.4	495	0.023	0.034	RAD18_HUMAN E3 ubiquitin-protein ligase RAD18 OS=Homo sapiens OX=9606 GN=RAD18 PE=1 SV=2
15	Q8I0J6	1.99e-04	46.6	312	0.036	0.087	Q8I0J6_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=2 SV=1
16	Q9VNJ0	2.03e-04	46.6	319	0.036	0.085	Q9VNJ0_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=1 SV=1
17	K4P3M7	2.07e-04	47.0	683	0.023	0.025	K4P3M7_9ALPH Immediate-early transactivator protein with Zn finger (Cell nucleus) OS=Bovine herpesvirus type 1.1 OX=79889 GN=BICP0 PE=1 SV=1
18	A0A0B4LHT4	2.08e-04	45.4	205	0.036	0.132	A0A0B4LHT4_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=4 SV=1
19	P29128	2.10e-04	47.0	676	0.023	0.025	ICP0_BHV1J E3 ubiquitin-protein ligase ICP0 OS=Bovine herpesvirus 1.1 (strain Jura) OX=31518 GN=BICP0 PE=1 SV=1
20	Q9QXK2	3.11e-04	46.6	509	0.023	0.033	RAD18_MOUSE E3 ubiquitin-protein ligase RAD18 OS=Mus musculus OX=10090 GN=Rad18 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18102 DTC	7.5e-61	215.5	Deltex C-terminal domain
2	PF00013 KH_1	4.1e+02	12.2	KH domain
3	PF00097 zf-C3HC4	0.016	26.4	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	2.6e-05	35.2	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	0.0079	27.3	Zinc finger, C3HC4 type (RING finger)
6	PF12678 zf-rbx1	22	16.7	RING-H2 zinc finger domain
7	PF16685 zf-RING_10	26	16.3	zinc RING finger of MSL2
8	PF13639 zf-RING_2	0.009	27.7	Ring finger domain
9	PF14570 zf-RING_4	9	17.5	RING/Ubox like zinc-binding domain
10	PF14634 zf-RING_5	1.1	20.6	zinc-RING finger domain
11	PF14835 zf-RING_6	7.5	17.8	zf-RING of BARD1-type protein
12	PF13445 zf-RING_UBOX	8.7	17.8	RING-type zinc-finger
13	PF14569 zf-UDP	5.4e+02	12.1	Zinc-binding RING-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296161

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353512	0.999	Poly [ADP-ribose] polymerase 9
2	9606.ENSP00000418194	0.972	Poly [ADP-ribose] polymerase 14
3	9606.ENSP00000263642	0.861	Interferon-induced helicase C domain-containing protein 1
4	9606.ENSP00000363019	0.756	Ubiquitin-conjugating enzyme E2 D1
5	9606.ENSP00000417214	0.743	Poly [ADP-ribose] polymerase 15
6	9606.ENSP00000354394	0.726	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000369213	0.710	Probable ATP-dependent RNA helicase DDX58
8	9606.ENSP00000464087	0.696	E3 ubiquitin-protein ligase RNF213
9	9606.ENSP00000333266	0.687	Ubiquitin-like modifier-activating enzyme 7
10	9606.ENSP00000298248	0.678	Lambda-crystallin homolog
11	9606.ENSP00000256646	0.674	Neurogenic locus notch homolog protein 2
12	9606.ENSP00000286371	0.672	Sodium/potassium-transporting ATPase subunit beta-3
13	9606.ENSP00000277541	0.670	Neurogenic locus notch homolog protein 1
14	9606.ENSP00000387365	0.670	Periodic tryptophan protein 1 homolog
15	9606.ENSP00000369461	0.665	Enoyl-CoA delta isomerase 2, mitochondrial
16	9606.ENSP00000370737	0.662	Glycine dehydrogenase (decarboxylating), mitochondrial
17	9606.ENSP00000263918	0.660	Striatin
18	9606.ENSP00000363869	0.658	V-set and immunoglobulin domain-containing protein 4
19	9606.ENSP00000368699	0.658	Ubiquitin-like protein ISG15
20	9606.ENSP00000415556	0.658	DDB1- and CUL4-associated factor 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061629	0.979	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019899	0.951	enzyme binding
GO:0098772	0.895	molecular function regulator activity
GO:0030674	0.895	protein-macromolecule adaptor activity
GO:0140767	0.883	enzyme-substrate adaptor activity
GO:0140678	0.878	molecular function inhibitor activity
GO:0097677	0.876	STAT family protein binding
GO:0042393	0.874	histone binding
GO:0044389	0.869	ubiquitin-like protein ligase binding
GO:0030234	0.859	enzyme regulator activity
GO:0004857	0.849	enzyme inhibitor activity
GO:0140768	0.572	protein ADP-ribosyltransferase-substrate adaptor activity
GO:1901363	0.378	heterocyclic compound binding
GO:0097159	0.377	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0044237	0.978	cellular metabolic process
GO:0032446	0.978	protein modification by small protein conjugation
GO:0051716	0.971	cellular response to stimulus
GO:0009893	0.966	positive regulation of metabolic process
GO:0048519	0.965	negative regulation of biological process
GO:0007165	0.962	signal transduction
GO:0006950	0.959	response to stress
GO:0044260	0.959	cellular macromolecule metabolic process
GO:0016567	0.957	protein ubiquitination
GO:0010604	0.951	positive regulation of macromolecule metabolic process
GO:0080090	0.948	regulation of primary metabolic process
GO:0048522	0.947	positive regulation of cellular process
GO:0051173	0.945	positive regulation of nitrogen compound metabolic process
GO:0048583	0.941	regulation of response to stimulus
GO:0048523	0.933	negative regulation of cellular process
GO:0010468	0.933	regulation of gene expression
GO:0031325	0.932	positive regulation of cellular metabolic process
GO:0030163	0.918	protein catabolic process
GO:0044248	0.913	cellular catabolic process
GO:0000209	0.891	protein polyubiquitination
GO:0044265	0.881	cellular macromolecule catabolic process
GO:0002831	0.874	regulation of response to biotic stimulus
GO:0019219	0.872	regulation of nucleobase-containing compound metabolic process
GO:0043632	0.870	modification-dependent macromolecule catabolic process
GO:0033554	0.865	cellular response to stress
GO:0006508	0.865	proteolysis
GO:0031399	0.858	regulation of protein modification process
GO:0009892	0.845	negative regulation of metabolic process
GO:0051252	0.842	regulation of RNA metabolic process
GO:0010605	0.835	negative regulation of macromolecule metabolic process
GO:0080134	0.824	regulation of response to stress
GO:0006355	0.816	regulation of DNA-templated transcription
GO:0051172	0.813	negative regulation of nitrogen compound metabolic process
GO:1903320	0.813	regulation of protein modification by small protein conjugation or removal
GO:0051603	0.812	proteolysis involved in protein catabolic process
GO:0065009	0.806	regulation of molecular function
GO:0000075	0.792	cell cycle checkpoint signaling
GO:0031347	0.790	regulation of defense response
GO:0031400	0.783	negative regulation of protein modification process
GO:0051179	0.781	localization
GO:0031396	0.776	regulation of protein ubiquitination
GO:0050688	0.760	regulation of defense response to virus
GO:0000077	0.756	DNA damage checkpoint signaling
GO:0019941	0.732	modification-dependent protein catabolic process
GO:0070936	0.731	protein K48-linked ubiquitination
GO:0051098	0.717	regulation of binding
GO:0007041	0.710	lysosomal transport
GO:0050691	0.704	regulation of defense response to virus by host
GO:0016570	0.703	histone modification
GO:0060341	0.702	regulation of cellular localization
GO:1903321	0.695	negative regulation of protein modification by small protein conjugation or removal
GO:0032880	0.684	regulation of protein localization
GO:0045935	0.587	positive regulation of nucleobase-containing compound metabolic process
GO:1900180	0.583	regulation of protein localization to nucleus
GO:0006511	0.575	ubiquitin-dependent protein catabolic process
GO:0006513	0.559	protein monoubiquitination
GO:0016574	0.554	histone ubiquitination
GO:1901360	0.544	organic cyclic compound metabolic process
GO:0046483	0.544	heterocycle metabolic process
GO:0031397	0.542	negative regulation of protein ubiquitination
GO:1903829	0.536	positive regulation of protein localization
GO:1900182	0.514	positive regulation of protein localization to nucleus
GO:0051254	0.447	positive regulation of RNA metabolic process
GO:0034641	0.446	cellular nitrogen compound metabolic process
GO:0045893	0.441	positive regulation of DNA-templated transcription
GO:0090304	0.438	nucleic acid metabolic process
GO:0044093	0.416	positive regulation of molecular function
GO:0051865	0.409	protein autoubiquitination
GO:0008333	0.369	endosome to lysosome transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.999	protein-containing complex
GO:0012505	0.999	endomembrane system
GO:0005654	0.999	nucleoplasm
GO:0031982	0.981	vesicle
GO:0031410	0.941	cytoplasmic vesicle
GO:0005768	0.893	endosome
GO:0005773	0.884	vacuole
GO:0000323	0.819	lytic vacuole
GO:0005764	0.797	lysosome
GO:0005769	0.773	early endosome
GO:0016020	0.390	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]