StarFunc result for job id Q8TDB8

User Input

>input (520 residues)
MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPET
IIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLI
VNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGT
LNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINR
KKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVL
QLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHM
IGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQG
PRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGR
TFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDB8	1.000	1.000	6.100E-68	520	1.000	1.000	Q8TDB8.pdb.gz	GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens OX=9606 GN=SLC2A14 PE=2 SV=1
2	AFDB:P32037	0.933	0.983	9.869E-54	493	0.773	0.815	P32037.pdb.gz	GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus OX=10090 GN=Slc2a3 PE=1 SV=1
3	PDB:7sptA	0.890	0.984	6.234E-53	470	0.846	0.936	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
4	AFDB:P11166	0.911	0.963	1.004E-47	492	0.583	0.616	P11166.pdb.gz	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
5	AFDB:A0A286Y8I9	0.894	0.846	2.151E-47	550	0.606	0.573	A0A286Y8I9.pdb.gz
6	AFDB:Q285P3	0.908	0.967	2.239E-47	488	0.579	0.617	Q285P3.pdb.gz	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
7	AFDB:F1R0Q1	0.896	0.952	2.330E-47	489	0.573	0.609	F1R0Q1.pdb.gz	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
8	AFDB:P46896	0.904	0.959	6.879E-47	490	0.590	0.627	P46896.pdb.gz	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
9	AFDB:F1NTJ1	0.829	0.867	6.241E-46	496	0.675	0.708	F1NTJ1.pdb.gz	F1NTJ1_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A14 PE=3 SV=2
10	AFDB:P14142	0.899	0.918	2.998E-43	509	0.538	0.550	P14142.pdb.gz	GLUT4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus OX=10090 GN=Slc2a4 PE=1 SV=3
11	AFDB:Q9I8M1	0.829	0.873	9.982E-43	492	0.579	0.612	Q9I8M1.pdb.gz	Q9I8M1_ONCMY Glucose transporter 1A OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
12	PDB:6thaA	0.759	0.870	4.345E-39	448	0.565	0.656	6thaA.pdb.gz
13	PDB:7wsmA	0.775	0.860	2.185E-34	464	0.531	0.595	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
14	PDB:4ybqB	0.830	0.931	1.883E-30	462	0.379	0.426	4ybqB.pdb.gz
15	PDB:4gbyA	0.775	0.845	5.589E-21	475	0.267	0.293	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:7aaqA	0.777	0.828	6.091E-19	487	0.246	0.263	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
17	PDB:4ja4A	0.639	0.737	3.435E-16	442	0.246	0.290	4ja4A.pdb.gz
18	PDB:7zh0A	0.637	0.666	2.747E-10	495	0.179	0.188	7zh0A.pdb.gz
19	PDB:7bc7A	0.568	0.667	1.055E-8	432	0.129	0.155	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
20	PDB:6s4mA	0.575	0.687	4.843E-8	426	0.133	0.162	6s4mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060VUB5	0.0	605	480	0.569	0.617	A0A060VUB5_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081471001 PE=3 SV=1
2	A0A060WJ53	0.0	562	477	0.537	0.585	A0A060WJ53_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006116001 PE=4 SV=1
3	F1NTJ1	0.0	712	496	0.675	0.708	F1NTJ1_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A14 PE=3 SV=2
4	F1R0Q1	0.0	619	489	0.581	0.618	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
5	P11166	0.0	629	492	0.588	0.622	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
6	P11167	0.0	627	492	0.588	0.622	GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus OX=10116 GN=Slc2a1 PE=1 SV=1
7	P11169	0.0	947	496	0.902	0.946	GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens OX=9606 GN=SLC2A3 PE=1 SV=1
8	P17809	0.0	630	492	0.590	0.624	GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus OX=10090 GN=Slc2a1 PE=1 SV=4
9	P27674	0.0	632	492	0.590	0.624	GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus OX=9913 GN=SLC2A1 PE=1 SV=1
10	P28568	0.0	710	496	0.673	0.706	GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A3 PE=2 SV=1
11	P32037	0.0	788	493	0.773	0.815	GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus OX=10090 GN=Slc2a3 PE=1 SV=1
12	P46896	0.0	622	490	0.590	0.627	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
13	Q07647	0.0	806	493	0.769	0.811	GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus OX=10116 GN=Slc2a3 PE=1 SV=1
14	Q285P3	0.0	615	488	0.583	0.621	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
15	Q6DFZ5	0.0	612	541	0.594	0.571	Q6DFZ5_DANRE Solute carrier family 2 member 3a OS=Danio rerio OX=7955 GN=zgc:92476 PE=1 SV=1
16	Q8TDB8	0.0	1051	520	1.000	1.000	GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens OX=9606 GN=SLC2A14 PE=2 SV=1
17	Q9DFV2	0.0	535	503	0.550	0.569	Q9DFV2_SALTR Muscle glucose transporter OS=Salmo trutta OX=8032 PE=2 SV=1
18	Q9I8M1	0.0	602	492	0.571	0.604	Q9I8M1_ONCMY Glucose transporter 1A OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
19	P14142	1.31e-179	516	509	0.538	0.550	GLUT4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus OX=10090 GN=Slc2a4 PE=1 SV=3
20	P14672	2.86e-179	515	509	0.538	0.550	GLUT4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens OX=9606 GN=SLC2A4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04463 2-thiour_desulf	3.5e+02	12.6	2-thiouracil desulfurase
2	PF07690 MFS_1	2.9e-12	57.8	Major Facilitator Superfamily
3	PF00083 Sugar_tr	1.3e-150	513.9	Sugar (and other) transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445929

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264867	0.931	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
2	9606.ENSP00000428056	0.910	Phosphatidylinositol 3-kinase regulatory subunit alpha
3	9606.ENSP00000263967	0.908	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
4	9606.ENSP00000271555	0.900	Myocyte-specific enhancer factor 2D
5	9606.ENSP00000340874	0.900	Myocyte-specific enhancer factor 2C
6	9606.ENSP00000346389	0.900	Myocyte-specific enhancer factor 2A
7	9606.ENSP00000075120	0.866	Solute carrier family 2, facilitated glucose transporter member 3
8	9606.ENSP00000445175	0.741	Lactate dehydrogenase A
9	9606.ENSP00000437955	0.740	Hypoxia-inducible factor 1-alpha
10	9606.ENSP00000463978	0.736	Monocarboxylate transporter 4
11	9606.ENSP00000358794	0.729	Monocarboxylate transporter 5
12	9606.ENSP00000290573	0.720	Hexokinase-2
13	9606.ENSP00000320171	0.693	Pyruvate kinase PKM
14	9606.ENSP00000380432	0.692	Insulin
15	9606.ENSP00000328551	0.681	Ras-related protein Rab-28
16	9606.ENSP00000286713	0.675	Erythrocyte band 7 integral membrane protein
17	9606.ENSP00000261187	0.666	Monocarboxylate transporter 2
18	9606.ENSP00000266088	0.660	Sodium/glucose cotransporter 1
19	9606.ENSP00000402103	0.633	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
20	9606.ENSP00000376352	0.627	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005355	1.000	glucose transmembrane transporter activity
GO:0008514	0.999	organic anion transmembrane transporter activity
GO:0090482	0.997	vitamin transmembrane transporter activity
GO:0005488	0.817	binding
GO:0005515	0.805	protein binding
GO:0022804	0.520	active transmembrane transporter activity
GO:0015291	0.494	secondary active transmembrane transporter activity
GO:0055056	0.444	D-glucose transmembrane transporter activity
GO:0015318	0.342	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0008643	0.983	carbohydrate transport
GO:0015749	0.974	monosaccharide transmembrane transport
GO:0008645	0.963	hexose transmembrane transport
GO:1904659	0.915	glucose transmembrane transport
GO:0051180	0.837	vitamin transport
GO:0008152	0.470	metabolic process
GO:0065007	0.440	biological regulation
GO:0015711	0.435	organic anion transport
GO:0071704	0.404	organic substance metabolic process
GO:0050789	0.371	regulation of biological process
GO:0050896	0.340	response to stimulus
GO:0050794	0.335	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.998	organelle
GO:0005634	0.982	nucleus
GO:0005737	0.930	cytoplasm
GO:0012505	0.583	endomembrane system
GO:0031982	0.458	vesicle
GO:0005615	0.384	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]