StarFunc result for job id Q8TDD2

User Input

>input (431 residues)
MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTM
GDAYPAPFTSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSD
CLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQG
TLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQL
EGSGGAKPPRGASTGGSGGYGGSGAGRSSCDCPNCQELERLGAAAAGLRKKPIHSCHIPG
CGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCS
KRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPG
GSPEQSNLLEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDD2	0.999	0.999	2.546E-69	431	1.000	1.000	Q8TDD2.pdb.gz	SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens OX=9606 GN=SP7 PE=1 SV=1
2	AFDB:Q6P0J3	0.224	0.221	2.872E-23	437	0.418	0.412	Q6P0J3.pdb.gz	SP8_DANRE Transcription factor Sp8 OS=Danio rerio OX=7955 GN=sp8b PE=2 SV=1
3	AFDB:Q9PUT7	0.204	0.210	1.786E-11	419	0.211	0.217	Q9PUT7.pdb.gz	Q9PUT7_DANRE WT1 transcription factor a OS=Danio rerio OX=7955 GN=wt1 PE=2 SV=1
4	AFDB:A0A2R8YDQ5	0.185	0.124	4.513E-11	659	0.234	0.153	A0A2R8YDQ5.pdb.gz	A0A2R8YDQ5_HUMAN Zinc finger protein 746 OS=Homo sapiens OX=9606 GN=ZNF746 PE=1 SV=1
5	AFDB:Q5BIH1	0.187	0.103	8.890E-10	803	0.216	0.116	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
6	AFDB:A0A0A0MT54	0.200	0.166	1.323E-9	522	0.220	0.182	A0A0A0MT54.pdb.gz	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
7	AFDB:Q96T25	0.201	0.132	5.680E-9	663	0.260	0.169	Q96T25.pdb.gz	ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens OX=9606 GN=ZIC5 PE=1 SV=2
8	AFDB:F1Q833	0.232	0.120	1.257E-8	908	0.251	0.119	F1Q833.pdb.gz
9	AFDB:Q921B4	0.195	0.106	1.436E-8	824	0.188	0.098	Q921B4.pdb.gz	NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus OX=10090 GN=Nrif2 PE=1 SV=1
10	AFDB:M9NEG1	0.183	0.075	1.751E-8	1109	0.190	0.074	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
11	PDB:3w5kB	0.103	0.242	4.504E-3	110	0.079	0.309	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7o4iW	0.047	0.061	6.913E-1	312	0.051	0.071	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:5dkaA	0.075	0.262	1.255	96	0.032	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:8d0kF	0.050	0.026	3.171	915	0.044	0.021	8d0kF.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
15	PDB:6g18v	0.057	0.067	4.134	325	0.021	0.028	6g18v.pdb.gz	Visualizing late states of human 40S ribosomal subunit maturation.
16	PDB:7ungi	0.060	0.086	4.134	250	0.056	0.096	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:5c8dE	0.039	0.052	4.417	280	0.026	0.039	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
18	PDB:5gm6a	0.044	0.096	4.417	123	0.042	0.146	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:7dvqM	0.035	0.071	4.417	191	0.035	0.079	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:7eghA	0.047	0.034	4.719	630	0.037	0.025	7eghA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IMK1	0.0	682	410	0.903	0.949	Q6IMK1_RAT Sp7 transcription factor OS=Rattus norvegicus OX=10116 GN=Sp7 PE=2 SV=1
2	Q6IMK2	0.0	716	428	0.942	0.949	Q6IMK2_RAT Sp7 transcription factor OS=Rattus norvegicus OX=10116 GN=Sp7 PE=4 SV=1
3	Q8TDD2	0.0	863	431	1.000	1.000	SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens OX=9606 GN=SP7 PE=1 SV=1
4	Q8VI67	0.0	717	428	0.947	0.953	SP7_MOUSE Transcription factor Sp7 OS=Mus musculus OX=10090 GN=Sp7 PE=1 SV=1
5	Q6U1J4	1.46e-167	479	440	0.585	0.573	Q6U1J4_DANRE Transcription factor Sp7 OS=Danio rerio OX=7955 GN=osx PE=2 SV=1
6	Q6NW96	3.70e-93	289	439	0.415	0.408	SP9_DANRE Transcription factor Sp9 OS=Danio rerio OX=7955 GN=sp9 PE=2 SV=1
7	Q64HY3	2.40e-89	281	484	0.406	0.362	SP9_MOUSE Transcription factor Sp9 OS=Mus musculus OX=10090 GN=Sp9 PE=1 SV=1
8	P0CG40	2.50e-89	281	484	0.406	0.362	SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens OX=9606 GN=SP9 PE=3 SV=1
9	Q6P0J3	5.32e-86	271	437	0.348	0.343	SP8_DANRE Transcription factor Sp8 OS=Danio rerio OX=7955 GN=sp8b PE=2 SV=1
10	Q8BMJ8	3.31e-75	244	486	0.327	0.290	SP8_MOUSE Transcription factor Sp8 OS=Mus musculus OX=10090 GN=Sp8 PE=2 SV=1
11	Q8IXZ3	4.99e-75	244	490	0.334	0.294	SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens OX=9606 GN=SP8 PE=1 SV=3
12	Q64HY5	1.55e-72	237	480	0.313	0.281	SP8_CHICK Transcription factor Sp8 OS=Gallus gallus OX=9031 GN=SP8 PE=2 SV=1
13	Q64HY4	5.84e-63	202	167	0.209	0.539	Q64HY4_CHICK SP9 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
14	Q8IRM5	3.36e-62	211	520	0.211	0.175	Q8IRM5_DROME Sp1, isoform B OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
15	Q9U1K4	1.75e-61	209	523	0.209	0.172	Q9U1K4_DROME C2H2 zinc finger transcription factor OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
16	A8JUN6	3.94e-61	213	715	0.211	0.127	A8JUN6_DROME Sp1, isoform D OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=2
17	R9PY21	4.14e-61	213	720	0.211	0.126	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
18	M9PJG1	4.51e-61	213	726	0.211	0.125	M9PJG1_DROME Sp1, isoform F OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
19	D3ZT88	1.88e-57	195	376	0.276	0.316	D3ZT88_RAT Sp6 transcription factor OS=Rattus norvegicus OX=10116 GN=Sp6 PE=4 SV=1
20	Q3SY56	2.88e-57	194	376	0.274	0.314	SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens OX=9606 GN=SP6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	7.3e-09	46.7	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	0.0079	27.9	C2H2-type zinc finger
3	PF15909 zf-C2H2_8	11	17.8	C2H2-type zinc ribbon
4	PF12171 zf-C2H2_jaz	6.7	18.4	Zinc-finger double-stranded RNA-binding
5	PF13465 zf-H2C2_2	4.7e-08	44.3	Zinc-finger double domain
6	PF08790 zf-LYAR	14	16.9	LYAR-type C2HC zinc finger
7	PF12874 zf-met	93	14.8	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000443827

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360493	0.971	Runt-related transcription factor 2
2	9606.ENSP00000389377	0.971	Nuclear factor of activated T-cells, cytoplasmic 1
3	9606.ENSP00000477507	0.943	Ribosomal oxygenase 1
4	9606.ENSP00000367952	0.920	Unique cartilage matrix-associated protein
5	9606.ENSP00000357255	0.913	Osteocalcin
6	9606.ENSP00000226284	0.880	Bone sialoprotein 2
7	9606.ENSP00000222598	0.874	Homeobox protein DLX-5
8	9606.ENSP00000378517	0.838	Osteopontin
9	9606.ENSP00000295569	0.833	Protein FAM19A4
10	9606.ENSP00000395654	0.820	Transcription activator BRG1
11	9606.ENSP00000368104	0.813	Bone morphogenetic protein 2
12	9606.ENSP00000225964	0.800	Collagen alpha-1(I) chain
13	9606.ENSP00000381775	0.779	Tumor necrosis factor ligand superfamily member 11
14	9606.ENSP00000327368	0.772	Collagen alpha-1(X) chain
15	9606.ENSP00000363973	0.760	Alkaline phosphatase, tissue-nonspecific isozyme
16	9606.ENSP00000301691	0.750	Sclerostin
17	9606.ENSP00000271651	0.748	Cathepsin K
18	9606.ENSP00000297350	0.735	Tumor necrosis factor receptor superfamily member 11B
19	9606.ENSP00000245479	0.720	Transcription factor SOX-9
20	9606.ENSP00000369889	0.701	Collagen alpha-1(II) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003690	0.998	double-stranded DNA binding
GO:0043565	0.996	sequence-specific DNA binding
GO:1990837	0.923	sequence-specific double-stranded DNA binding
GO:0140110	0.921	transcription regulator activity
GO:0003700	0.777	DNA-binding transcription factor activity
GO:0001067	0.386	transcription regulatory region nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0032502	0.987	developmental process
GO:0050794	0.987	regulation of cellular process
GO:0032501	0.986	multicellular organismal process
GO:0048856	0.984	anatomical structure development
GO:0019222	0.940	regulation of metabolic process
GO:0060255	0.928	regulation of macromolecule metabolic process
GO:0051171	0.913	regulation of nitrogen compound metabolic process
GO:0080090	0.912	regulation of primary metabolic process
GO:0031323	0.912	regulation of cellular metabolic process
GO:0050896	0.911	response to stimulus
GO:0010468	0.908	regulation of gene expression
GO:0048518	0.890	positive regulation of biological process
GO:0048522	0.875	positive regulation of cellular process
GO:0019219	0.873	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.872	regulation of macromolecule biosynthetic process
GO:0031326	0.864	regulation of cellular biosynthetic process
GO:0009893	0.858	positive regulation of metabolic process
GO:0006355	0.852	regulation of DNA-templated transcription
GO:0010604	0.831	positive regulation of macromolecule metabolic process
GO:0031325	0.824	positive regulation of cellular metabolic process
GO:0051173	0.817	positive regulation of nitrogen compound metabolic process
GO:0051716	0.784	cellular response to stimulus
GO:0007154	0.776	cell communication
GO:0050793	0.711	regulation of developmental process
GO:0045935	0.697	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.693	positive regulation of cellular biosynthetic process
GO:0010557	0.692	positive regulation of macromolecule biosynthetic process
GO:0045893	0.672	positive regulation of DNA-templated transcription
GO:0006357	0.654	regulation of transcription by RNA polymerase II
GO:0045595	0.649	regulation of cell differentiation
GO:0048869	0.646	cellular developmental process
GO:0030154	0.642	cell differentiation
GO:0007275	0.584	multicellular organism development
GO:0045944	0.535	positive regulation of transcription by RNA polymerase II
GO:0048513	0.521	animal organ development
GO:0008152	0.519	metabolic process
GO:0048519	0.507	negative regulation of biological process
GO:0051094	0.503	positive regulation of developmental process
GO:0048523	0.470	negative regulation of cellular process
GO:0042221	0.467	response to chemical
GO:0071704	0.464	organic substance metabolic process
GO:0048731	0.426	system development
GO:0045597	0.394	positive regulation of cell differentiation
GO:0044238	0.359	primary metabolic process
GO:0009653	0.322	anatomical structure morphogenesis
GO:0010033	0.317	response to organic substance
GO:0009719	0.315	response to endogenous stimulus
GO:0009888	0.315	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0005829	0.310	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]