StarFunc result for job id Q8TDF5

User Input

>input (533 residues)
MIHGRSVLHIVASLIILHLSGATKKGTEKQTTSETQKSVQCGTWTKHAEGGIFTSPNYPS
KYPPDRECIYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGALKPLPACEFEMGGSE
GIVESIQIMKEGKATASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIIS
VIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVADDFENYHKL
RRSSSKCIHDHHCGSQLSSTKGSRSNLSTRDASILTEMPTQPGKPLIPPMNRRNILVMKH
SYSQDAADACDIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R4I7	0.724	0.724	2.176E-87	533	0.957	0.957	Q8R4I7.pdb.gz	NETO1_MOUSE Neuropilin and tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Neto1 PE=1 SV=2
2	AFDB:C6K2K4	0.551	0.559	5.989E-64	525	0.552	0.560	C6K2K4.pdb.gz	NETO2_RAT Neuropilin and tolloid-like protein 2 OS=Rattus norvegicus OX=10116 GN=Neto2 PE=1 SV=1
3	AFDB:G4LU05	0.380	0.265	9.471E-35	822	0.255	0.165	G4LU05.pdb.gz	G4LU05_DROME Neuropilin and tolloid-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Neto PE=2 SV=1
4	AFDB:Q9VYC7	0.337	0.277	3.914E-34	677	0.263	0.207	Q9VYC7.pdb.gz	Q9VYC7_DROME GH11189p OS=Drosophila melanogaster OX=7227 GN=Neto PE=2 SV=2
5	AFDB:B3DFP6	0.217	0.127	7.404E-22	927	0.148	0.085	B3DFP6.pdb.gz
6	AFDB:O35375	0.215	0.126	9.624E-21	931	0.152	0.087	O35375.pdb.gz	NRP2_MOUSE Neuropilin-2 OS=Mus musculus OX=10090 GN=Nrp2 PE=1 SV=2
7	AFDB:O14786	0.201	0.120	2.837E-19	923	0.141	0.081	O14786.pdb.gz	NRP1_HUMAN Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=3
8	PDB:7b01A	0.184	0.171	5.967E-8	588	0.060	0.054	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
9	PDB:6l4cC	0.107	0.152	3.350E-5	353	0.049	0.074	6l4cC.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
10	PDB:4lejA	0.104	0.145	1.241E-4	355	0.045	0.068	4lejA.pdb.gz	Crystal Structure of Korean Pine ( Pinus koraiensis ) 7S Seed Storage Protein with Copper Ligands.
11	PDB:3lxuX	0.146	0.076	2.262E-4	1217	0.058	0.025	3lxuX.pdb.gz
12	PDB:3am2A	0.154	0.260	3.501E-4	286	0.068	0.126	3am2A.pdb.gz
13	PDB:3fz3B	0.092	0.113	4.599E-4	410	0.064	0.083	3fz3B.pdb.gz	Crystal structure of prunin-1, a major component of the almond (Prunus dulcis) allergen amandin.
14	PDB:2vqaA	0.121	0.169	4.857E-4	356	0.053	0.079	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
15	PDB:1fxzA	0.090	0.121	1.228E-3	371	0.051	0.073	1fxzA.pdb.gz
16	PDB:1uijC	0.097	0.139	1.528E-3	346	0.036	0.055	1uijC.pdb.gz
17	PDB:3aclA	0.123	0.203	1.704E-3	288	0.056	0.104	3aclA.pdb.gz	A small-molecule inhibitor shows that pirin regulates migration of melanoma cells
18	AFDB:Q8K5B1	0.101	0.082	4.136E-3	716	0.099	0.074	Q8K5B1.pdb.gz	IL31R_MOUSE Interleukin-31 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il31ra PE=1 SV=3
19	AFDB:A2VDJ0	0.088	0.041	2.793E-2	1609	0.088	0.029	A2VDJ0.pdb.gz	T131L_HUMAN Transmembrane protein 131-like OS=Homo sapiens OX=9606 GN=TMEM131L PE=1 SV=2
20	AFDB:Q6UWL6	0.097	0.080	4.092E-2	708	0.103	0.078	Q6UWL6.pdb.gz	KIRR2_HUMAN Kin of IRRE-like protein 2 OS=Homo sapiens OX=9606 GN=KIRREL2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C6K2K4	0.0	628	525	0.555	0.564	NETO2_RAT Neuropilin and tolloid-like protein 2 OS=Rattus norvegicus OX=10116 GN=Neto2 PE=1 SV=1
2	Q8BNJ6	0.0	629	525	0.553	0.562	NETO2_MOUSE Neuropilin and tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Neto2 PE=1 SV=1
3	Q8NC67	0.0	628	525	0.553	0.562	NETO2_HUMAN Neuropilin and tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=NETO2 PE=1 SV=1
4	Q8R4I7	0.0	1052	533	0.957	0.957	NETO1_MOUSE Neuropilin and tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Neto1 PE=1 SV=2
5	Q8TDF5	0.0	1119	533	1.000	1.000	NETO1_HUMAN Neuropilin and tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=NETO1 PE=2 SV=2
6	G4LU05	7.18e-52	191	822	0.201	0.130	G4LU05_DROME Neuropilin and tolloid-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Neto PE=2 SV=1
7	Q9VYC7	1.31e-51	189	677	0.201	0.158	Q9VYC7_DROME GH11189p OS=Drosophila melanogaster OX=7227 GN=Neto PE=2 SV=2
8	O60494	5.41e-29	124	3623	0.141	0.021	CUBN_HUMAN Cubilin OS=Homo sapiens OX=9606 GN=CUBN PE=1 SV=5
9	O70244	5.82e-29	124	3623	0.148	0.022	CUBN_RAT Cubilin OS=Rattus norvegicus OX=10116 GN=Cubn PE=1 SV=2
10	Q9JLB4	1.41e-28	123	3623	0.143	0.021	CUBN_MOUSE Cubilin OS=Mus musculus OX=10090 GN=Cubn PE=1 SV=3
11	Q62381	5.03e-26	115	1013	0.148	0.078	TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Tll1 PE=1 SV=1
12	O35276	5.08e-26	115	925	0.158	0.091	NRP2_RAT Neuropilin-2 OS=Rattus norvegicus OX=10116 GN=Nrp2 PE=2 SV=1
13	O35375	6.11e-26	114	931	0.159	0.091	NRP2_MOUSE Neuropilin-2 OS=Mus musculus OX=10090 GN=Nrp2 PE=1 SV=2
14	Q8JI28	1.05e-25	114	1007	0.167	0.088	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
15	O43897	3.52e-25	112	1013	0.144	0.076	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
16	O57460	3.84e-25	112	1022	0.167	0.087	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
17	Q9WVM6	8.62e-25	111	1012	0.141	0.074	TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Tll2 PE=1 SV=1
18	O60462	8.93e-25	111	931	0.152	0.087	NRP2_HUMAN Neuropilin-2 OS=Homo sapiens OX=9606 GN=NRP2 PE=1 SV=3
19	Q9Y6L7	9.03e-25	111	1015	0.141	0.074	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
20	Q9TU53	1.51e-24	111	3620	0.116	0.017	CUBN_CANLF Cubilin OS=Canis lupus familiaris OX=9615 GN=CUBN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	6.4e-36	134.4	CUB domain
2	PF00057 Ldl_recept_a	0.0013	30.2	Low-density lipoprotein receptor domain class A
3	PF12264 Waikav_capsid_1	4.6e+02	11.7	Waikavirus capsid protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313088

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379818	0.929	Glutamate receptor ionotropic, NMDA 2A
2	9606.ENSP00000325448	0.857	Lysine--tRNA ligase
3	9606.ENSP00000284981	0.853	Amyloid-beta A4 protein
4	9606.ENSP00000382428	0.829	Disks large homolog 4
5	9606.ENSP00000397026	0.795	Glutamate receptor ionotropic, kainate 2
6	9606.ENSP00000360608	0.721	Glutamate receptor ionotropic, NMDA 1
7	9606.ENSP00000382791	0.697	Glutamate receptor ionotropic, kainate 1
8	9606.ENSP00000477455	0.680	Glutamate receptor ionotropic, NMDA 2B
9	9606.ENSP00000435648	0.664	Glutamate receptor ionotropic, kainate 4
10	9606.ENSP00000423190	0.636	Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
11	9606.ENSP00000417273	0.630	Cytoplasmic protein NCK1
12	9606.ENSP00000262895	0.613	Glutamate receptor ionotropic, kainate 5
13	9606.ENSP00000400882	0.602	Calpain small subunit 2
14	9606.ENSP00000385035	0.599	Complement C1s subcomponent
15	9606.ENSP00000300105	0.586	Voltage-dependent calcium channel gamma-2 subunit
16	9606.ENSP00000440498	0.579	Ganglioside-induced differentiation-associated protein 1-like 1
17	9606.ENSP00000267615	0.576	Inositol-tetrakisphosphate 1-kinase
18	9606.ENSP00000362183	0.573	Glutamate receptor ionotropic, kainate 3
19	9606.ENSP00000454014	0.570	Protein shisa-9
20	9606.ENSP00000262134	0.546	Lysophosphatidylcholine acyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035254	0.989	glutamate receptor binding
GO:0035255	0.960	ionotropic glutamate receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.942	response to stimulus
GO:0023051	0.909	regulation of signaling
GO:0010646	0.908	regulation of cell communication
GO:0048583	0.903	regulation of response to stimulus
GO:0032501	0.902	multicellular organismal process
GO:0009966	0.892	regulation of signal transduction
GO:0099601	0.876	regulation of neurotransmitter receptor activity
GO:0032879	0.870	regulation of localization
GO:0035418	0.863	protein localization to synapse
GO:1990778	0.845	protein localization to cell periphery
GO:0097120	0.841	receptor localization to synapse
GO:0072657	0.836	protein localization to membrane
GO:0062237	0.822	protein localization to postsynapse
GO:0099072	0.787	regulation of postsynaptic membrane neurotransmitter receptor levels
GO:1904062	0.771	regulation of monoatomic cation transmembrane transport
GO:0032412	0.740	regulation of monoatomic ion transmembrane transporter activity
GO:0043266	0.672	regulation of potassium ion transport
GO:2001257	0.640	regulation of cation channel activity
GO:0002028	0.623	regulation of sodium ion transport
GO:0051239	0.572	regulation of multicellular organismal process
GO:0048518	0.536	positive regulation of biological process
GO:0007611	0.533	learning or memory
GO:0048522	0.515	positive regulation of cellular process
GO:0031644	0.507	regulation of nervous system process
GO:0099177	0.496	regulation of trans-synaptic signaling
GO:1903539	0.487	protein localization to postsynaptic membrane
GO:0050804	0.486	modulation of chemical synaptic transmission
GO:1902305	0.448	regulation of sodium ion transmembrane transport
GO:2000649	0.410	regulation of sodium ion transmembrane transporter activity
GO:1901016	0.405	regulation of potassium ion transmembrane transporter activity
GO:0042391	0.402	regulation of membrane potential
GO:0033365	0.372	protein localization to organelle
GO:0051234	0.323	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005886	0.998	plasma membrane
GO:0045202	0.995	synapse
GO:0098978	0.971	glutamatergic synapse
GO:0098590	0.920	plasma membrane region
GO:0098794	0.915	postsynapse
GO:0099572	0.900	postsynaptic specialization
GO:0098839	0.890	postsynaptic density membrane
GO:0005622	0.803	intracellular anatomical structure
GO:0043231	0.770	intracellular membrane-bounded organelle
GO:0005737	0.760	cytoplasm
GO:0060076	0.314	excitatory synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]