StarFunc result for job id Q8TDG2

User Input

>input (376 residues)
MFNPHALDVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQKYFVGQE
ALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIRE
KLAEMMFETFSVPGFYLSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTK
LCMAGRDITEHLTRLLFASGFNFPCILNKAVVNNIKEKLCYIALEPEKELRKSRGEVLGA
YRLPDGHVIHFGDELYQVPEVLFAPDQLGIHSPGLSKMVSSSIMKCDTDIQNKLYADIVL
SGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDRCFSAWIGASIMTSMSSFKQMWVTS
ADFKEYGTSVVQRRCF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDG2	1.000	1.000	1.172E-77	376	1.000	1.000	Q8TDG2.pdb.gz	ACTT1_HUMAN Actin-related protein T1 OS=Homo sapiens OX=9606 GN=ACTRT1 PE=2 SV=2
2	AFDB:Q4YU79	0.947	0.947	1.130E-51	376	0.473	0.473	Q4YU79.pdb.gz	ACT2_PLABA Actin-2 OS=Plasmodium berghei (strain Anka) OX=5823 GN=ACT2 PE=1 SV=1
3	AFDB:P10989	0.955	0.957	1.195E-51	375	0.463	0.464	P10989.pdb.gz	ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act1 PE=1 SV=1
4	AFDB:P07829	0.957	0.957	2.469E-51	376	0.468	0.468	P07829.pdb.gz	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
5	AFDB:P0CJ46	0.950	0.947	6.742E-51	377	0.468	0.467	P0CJ46.pdb.gz	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
6	AFDB:A0A1D8PFR4	0.957	0.957	9.423E-51	376	0.463	0.463	A0A1D8PFR4.pdb.gz	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
7	AFDB:Q9U1E8	0.952	0.952	1.557E-50	376	0.465	0.465	Q9U1E8.pdb.gz	Q9U1E8_LEIMA Actin OS=Leishmania major OX=5664 GN=ACT PE=3 SV=1
8	AFDB:B6VNT8	0.957	0.954	1.647E-50	377	0.471	0.469	B6VNT8.pdb.gz	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
9	AFDB:Q562R1	0.955	0.955	2.177E-50	376	0.465	0.465	Q562R1.pdb.gz	ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2
10	AFDB:Q8RYC2	0.945	0.940	3.597E-50	378	0.452	0.450	Q8RYC2.pdb.gz	ACT5_ARATH Putative actin-5 OS=Arabidopsis thaliana OX=3702 GN=ACT5 PE=5 SV=1
11	PDB:1yagA	0.938	0.948	8.330E-50	372	0.463	0.468	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
12	PDB:6tu4A	0.931	0.941	2.507E-48	372	0.468	0.473	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
13	PDB:1c0gA	0.921	0.941	2.804E-48	368	0.471	0.481	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
14	PDB:4cbxA	0.905	0.950	1.496E-47	358	0.465	0.489	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
15	PDB:4pl7A	0.885	0.871	1.011E-43	382	0.449	0.442	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
16	PDB:4a7fA	0.900	0.903	3.592E-38	375	0.476	0.477	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.
17	PDB:7nvmK	0.716	0.840	2.393E-33	317	0.428	0.508	7nvmK.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
18	PDB:3dwlA	0.748	0.787	7.203E-32	355	0.319	0.338	3dwlA.pdb.gz	Structure and biochemical properties of fission yeast arp2/3 complex lacking the arp2 subunit.
19	PDB:6w18B	0.839	0.859	5.372E-31	367	0.364	0.373	6w18B.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
20	PDB:6w17A	0.866	0.858	5.680E-31	380	0.319	0.316	6w17A.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TDG2	0.0	783	376	1.000	1.000	ACTT1_HUMAN Actin-related protein T1 OS=Homo sapiens OX=9606 GN=ACTRT1 PE=2 SV=2
2	P10984	9.33e-134	389	376	0.487	0.487	ACT2_CAEEL Actin-2 OS=Caenorhabditis elegans OX=6239 GN=act-2 PE=3 SV=3
3	P29751	1.01e-133	389	375	0.484	0.485	ACTB_RABIT Actin, cytoplasmic 1 OS=Oryctolagus cuniculus OX=9986 GN=ACTB PE=2 SV=1
4	P60706	2.23e-133	388	375	0.484	0.485	ACTB_CHICK Actin, cytoplasmic 1 OS=Gallus gallus OX=9031 GN=ACTB PE=1 SV=1
5	P60709	2.23e-133	388	375	0.484	0.485	ACTB_HUMAN Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1
6	P60710	2.23e-133	388	375	0.484	0.485	ACTB_MOUSE Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1
7	P60711	2.23e-133	388	375	0.484	0.485	ACTB_RAT Actin, cytoplasmic 1 OS=Rattus norvegicus OX=10116 GN=Actb PE=1 SV=1
8	P60712	2.23e-133	388	375	0.484	0.485	ACTB_BOVIN Actin, cytoplasmic 1 OS=Bos taurus OX=9913 GN=ACTB PE=1 SV=1
9	Q1KLZ0	2.23e-133	388	375	0.484	0.485	Q1KLZ0_HUMAN HCG15971, isoform CRA_a OS=Homo sapiens OX=9606 GN=PS1TP5BP1 PE=1 SV=1
10	Q58J72	2.23e-133	388	375	0.484	0.485	Q58J72_MELGA Beta-actin OS=Meleagris gallopavo OX=9103 PE=2 SV=1
11	Q6QAQ1	2.23e-133	388	375	0.484	0.485	ACTB_PIG Actin, cytoplasmic 1 OS=Sus scrofa OX=9823 GN=ACTB PE=1 SV=2
12	P60009	6.28e-133	387	375	0.465	0.467	ACT_CANGA Actin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ACT1 PE=3 SV=1
13	P60010	6.28e-133	387	375	0.465	0.467	ACT_YEAST Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACT1 PE=1 SV=1
14	P10986	6.36e-133	387	376	0.484	0.484	ACT4_CAEEL Actin-4 OS=Caenorhabditis elegans OX=6239 GN=act-4 PE=3 SV=2
15	P63259	7.32e-133	386	375	0.481	0.483	ACTG_RAT Actin, cytoplasmic 2 OS=Rattus norvegicus OX=10116 GN=Actg1 PE=1 SV=1
16	P63260	7.32e-133	386	375	0.481	0.483	ACTG_MOUSE Actin, cytoplasmic 2 OS=Mus musculus OX=10090 GN=Actg1 PE=1 SV=1
17	P63261	7.32e-133	386	375	0.481	0.483	ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1
18	P0DM41	1.32e-132	386	376	0.481	0.481	ACT1_CAEEL Actin-1 OS=Caenorhabditis elegans OX=6239 GN=act-1 PE=1 SV=1
19	P0DM42	1.32e-132	386	376	0.481	0.481	ACT3_CAEEL Actin-3 OS=Caenorhabditis elegans OX=6239 GN=act-3 PE=3 SV=1
20	G1NS52	1.71e-132	385	376	0.479	0.479	G1NS52_MELGA Uncharacterized protein OS=Meleagris gallopavo OX=9103 GN=LOC100542800 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	5.5e-111	382.6	Actin
2	PF06723 MreB_Mbl	92	13.3	MreB/Mbl protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360165

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392879	0.704	T-complex 11 family, X-linked 2
2	9606.ENSP00000360166	0.661	Proline-rich protein 32
3	9606.ENSP00000430128	0.655	RNA-binding Raly-like protein
4	9606.ENSP00000305847	0.640	Sperm acrosome associated 5
5	9606.ENSP00000304762	0.639	Sperm acrosome associated 5B
6	9606.ENSP00000307369	0.636	SH2 domain-containing adapter protein E
7	9606.ENSP00000334996	0.635	Calicin
8	9606.ENSP00000432660	0.614	Cofilin-1
9	9606.ENSP00000480740	0.611	Leucine-rich repeat-containing protein 39
10	9606.ENSP00000331933	0.583	WSC domain containing 2
11	9606.ENSP00000351379	0.554	Profilin-3
12	9606.ENSP00000423190	0.552	Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
13	9606.ENSP00000351113	0.551	Protein furry homolog-like
14	9606.ENSP00000360485	0.542	A-kinase anchor protein 14
15	9606.ENSP00000263168	0.521	F-actin-capping protein subunit alpha-1
16	9606.ENSP00000405210	0.518	Sperm protein associated with the nucleus on the X chromosome N4
17	9606.ENSP00000354947	0.515	F-actin-capping protein subunit alpha-2
18	9606.ENSP00000432816	0.515	Acrosomal vesicle protein 1
19	9606.ENSP00000407353	0.512	Lamin tail domain containing 1
20	9606.ENSP00000260600	0.501	Adenylate cyclase type 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.990	chromatin binding
GO:1901363	0.736	heterocyclic compound binding
GO:0097159	0.736	organic cyclic compound binding
GO:0044877	0.534	protein-containing complex binding
GO:0008092	0.527	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.968	regulation of cellular process
GO:0009987	0.946	cellular process
GO:0019222	0.835	regulation of metabolic process
GO:0048519	0.818	negative regulation of biological process
GO:0048523	0.812	negative regulation of cellular process
GO:0080090	0.794	regulation of primary metabolic process
GO:0051171	0.793	regulation of nitrogen compound metabolic process
GO:0031323	0.793	regulation of cellular metabolic process
GO:0060255	0.788	regulation of macromolecule metabolic process
GO:0048583	0.767	regulation of response to stimulus
GO:0019219	0.729	regulation of nucleobase-containing compound metabolic process
GO:0008589	0.729	regulation of smoothened signaling pathway
GO:0009889	0.655	regulation of biosynthetic process
GO:0051252	0.655	regulation of RNA metabolic process
GO:0010556	0.651	regulation of macromolecule biosynthetic process
GO:0031326	0.651	regulation of cellular biosynthetic process
GO:1903506	0.628	regulation of nucleic acid-templated transcription
GO:0010468	0.623	regulation of gene expression
GO:0031324	0.584	negative regulation of cellular metabolic process
GO:0006355	0.577	regulation of DNA-templated transcription
GO:0071840	0.575	cellular component organization or biogenesis
GO:0016043	0.573	cellular component organization
GO:0051172	0.562	negative regulation of nitrogen compound metabolic process
GO:0045934	0.549	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.544	negative regulation of macromolecule metabolic process
GO:0009890	0.544	negative regulation of biosynthetic process
GO:0051253	0.489	negative regulation of RNA metabolic process
GO:0010558	0.485	negative regulation of macromolecule biosynthetic process
GO:0031327	0.484	negative regulation of cellular biosynthetic process
GO:1903507	0.449	negative regulation of nucleic acid-templated transcription
GO:0045892	0.390	negative regulation of DNA-templated transcription
GO:0032501	0.305	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005634	0.977	nucleus
GO:0043232	0.904	intracellular non-membrane-bounded organelle
GO:0005856	0.540	cytoskeleton
GO:0031982	0.370	vesicle
GO:0032991	0.340	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]