StarFunc result for job id Q8TDG4

User Input

>input (1101 residues)
MDECGSRIRRRVSLPKRNRPSLGCIFGAPTAAELVPGDEGKEEEEMVAENRRRKTAGVLP
VEVQPLLLSDSPECLVLGGGDTNPDLLRHMPTDRGVGDQPNDSEVDMFGDYDSFTENSFI
AQVDDLEQKYMQLPEHKKHATDFATENLCSESIKNKLSITTIGNLTELQTDKHTENQSGY
EGVTIEPGADLLYDVPSSQAIYFENLQNSSNDLGDHSMKERDWKSSSHNTVNEELPHNCI
EQPQQNDESSSKVRTSSDMNRRKSIKDHLKNAMTGNAKAQTPIFSRSKQLKDTLLSEEIN
VAKKTVESSSNDLGPFYSLPSKVRDLYAQFKGIEKLYEWQHTCLTLNSVQERKNLIYSLP
TSGGKTLVAEILMLQELLCCRKDVLMILPYVAIVQEKISGLSSFGIELGFFVEEYAGSKG
RFPPTKRREKKSLYIATIEKGHSLVNSLIETGRIDSLGLVVVDELHMIGEGSRGATLEMT
LAKILYTSKTTQIIGMSATLNNVEDLQKFLQAEYYTSQFRPVELKEYLKINDTIYEVDSK
AENGMTFSRLLNYKYSDTLKKMDPDHLVALVTEVIPNYSCLVFCPSKKNCENVAEMICKF
LSKEYLKHKEKEKCEVIKNLKNIGNGNLCPVLKRTIPFGVAYHHSGLTSDERKLLEEAYS
TGVLCLFTCTSTLAAGVNLPARRVILRAPYVAKEFLKRNQYKQMIGRAGRAGIDTIGESI
LILQEKDKQQVLELITKPLENCYSHLVQEFTKGIQTLFLSLIGLKIATNLDDIYHFMNGT
FFGVQQKVLLKEKSLWEITVESLRYLTEKGLLQKDTIYKSEEEVQYNFHITKLGRASFKG
TIDLAYCDILYRDLKKGLEGLVLESLLHLIYLTTPYDLVSQCNPDWMIYFRQFSQLSPAE
QNVAAILGVSESFIGKKASGQAIGKKVDKNVVNRLYLSFVLYTLLKETNIWTVSEKFNMP
RGYIQNLLTGTASFSSCVLHFCEELEEFWVYRALLVELTKKLTYCVKAELIPLMEVTGVL
EGRAKQLYSAGYKSLMHLANANPEVLVRTIDHLSRRQAKQIVSSAKMLLHEKAEALQEEV
EELLRLPSDFPGAVASSTDKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDG4	1.000	1.000	0.000	1101	1.000	1.000	Q8TDG4.pdb.gz	HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens OX=9606 GN=HELQ PE=1 SV=2
2	AFDB:H2KY86	0.647	0.768	9.778E-62	923	0.289	0.345	H2KY86.pdb.gz	HELQ_CAEEL Helicase POLQ-like OS=Caenorhabditis elegans OX=6239 GN=helq-1 PE=3 SV=1
3	PDB:5dcaA	0.398	0.240	1.139E-23	1948	0.150	0.085	5dcaA.pdb.gz
4	PDB:3jcmN	0.424	0.290	4.252E-23	1686	0.160	0.104	3jcmN.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
5	PDB:6qw65B	0.414	0.243	5.781E-23	2001	0.138	0.076	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
6	PDB:6d6qM	0.436	0.654	3.141E-21	709	0.114	0.178	6d6qM.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
7	PDB:2xgjB	0.405	0.556	5.091E-21	777	0.123	0.174	2xgjB.pdb.gz	Structural Analysis Reveals the Characteristic Features of Mtr4, a Dexh Helicase Involved in Nuclear RNA Processing and Surveillance.
8	PDB:6ro1A	0.405	0.478	5.091E-21	919	0.117	0.140	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
9	PDB:6iegA	0.401	0.498	1.666E-20	872	0.116	0.147	6iegA.pdb.gz	NRDE2 negatively regulates exosome functions by inhibiting MTR4 recruitment and exosome interaction.
10	PDB:7z4yB	0.403	0.472	4.026E-18	930	0.118	0.140	7z4yB.pdb.gz
11	PDB:4xgtA	0.329	0.373	5.137E-17	961	0.128	0.147	4xgtA.pdb.gz
12	PDB:7qdyA	0.333	0.315	2.388E-16	1169	0.133	0.125	7qdyA.pdb.gz	The human SKI complex regulates channeling of ribosome-bound RNA to the exosome via an intrinsic gatekeeping mechanism.
13	AFDB:A0A2R8RUE4	0.264	0.206	1.138E-13	1439	0.130	0.099	A0A2R8RUE4.pdb.gz
14	AFDB:Q22308	0.246	0.263	2.072E-10	1022	0.110	0.118	Q22308.pdb.gz	Q22308_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-19 PE=1 SV=2
15	AFDB:F4IV99	0.235	0.157	3.926E-9	1724	0.170	0.108	F4IV99.pdb.gz	CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana OX=3702 GN=CHR5 PE=1 SV=1
16	AFDB:Q9SQV1	0.269	0.272	6.089E-9	1088	0.104	0.105	Q9SQV1.pdb.gz	RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana OX=3702 GN=RH40 PE=2 SV=1
17	AFDB:Q9LK10	0.219	0.214	2.958E-8	1132	0.109	0.106	Q9LK10.pdb.gz	CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana OX=3702 GN=CLSY4 PE=1 SV=1
18	AFDB:P51532	0.224	0.156	3.791E-5	1647	0.105	0.070	P51532.pdb.gz	SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2
19	AFDB:Q9Z1N2	0.112	0.134	2.616E-4	840	0.088	0.115	Q9Z1N2.pdb.gz	ORC1_MOUSE Origin recognition complex subunit 1 OS=Mus musculus OX=10090 GN=Orc1 PE=1 SV=2
20	AFDB:Q9Y794	0.120	0.133	4.837E-4	972	0.095	0.108	Q9Y794.pdb.gz	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2VPA6	0.0	1670	1069	0.754	0.776	HELQ_MOUSE Helicase POLQ-like OS=Mus musculus OX=10090 GN=Helq PE=1 SV=2
2	Q8TDG4	0.0	2276	1101	1.000	1.000	HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens OX=9606 GN=HELQ PE=1 SV=2
3	Q9VSE2	0.0	669	1051	0.319	0.334	HELQ_DROME Helicase POLQ-like OS=Drosophila melanogaster OX=7227 GN=mus301 PE=1 SV=1
4	H2KY86	3.14e-171	529	923	0.280	0.334	HELQ_CAEEL Helicase POLQ-like OS=Caenorhabditis elegans OX=6239 GN=helq-1 PE=3 SV=1
5	Q57YX8	3.40e-133	432	1057	0.261	0.272	Q57YX8_TRYB2 DNA polymerase theta (Helicase domain only), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.410 PE=4 SV=1
6	Q588V7	1.44e-128	436	2154	0.255	0.130	TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana OX=3702 GN=TEB PE=2 SV=1
7	O75417	1.13e-126	431	2590	0.248	0.105	DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens OX=9606 GN=POLQ PE=1 SV=2
8	Q8CGS6	2.81e-124	423	2544	0.255	0.110	DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus OX=10090 GN=Polq PE=1 SV=2
9	O18475	5.22e-122	416	2059	0.244	0.131	DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster OX=7227 GN=PolQ PE=1 SV=1
10	A0FLQ6	1.04e-52	205	1661	0.151	0.100	DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans OX=6239 GN=polq-1 PE=1 SV=3
11	Q582D6	4.65e-34	145	2237	0.120	0.059	Q582D6_TRYB2 ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.290 PE=4 SV=1
12	P32639	1.92e-33	143	2163	0.119	0.061	BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRR2 PE=1 SV=2
13	Q9UT24	3.68e-32	139	2176	0.121	0.061	BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brr2 PE=1 SV=1
14	Q9VUV9	7.11e-31	134	2142	0.126	0.065	U520_DROME U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster OX=7227 GN=Brr2 PE=2 SV=4
15	O75643	1.13e-29	130	2136	0.146	0.075	U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2
16	A0A494C1A5	1.48e-29	130	1375	0.141	0.113	A0A494C1A5_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase (Fragment) OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=1
17	O48534	2.90e-29	129	2172	0.132	0.067	DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana OX=3702 GN=BRR2B PE=2 SV=1
18	Q9SYP1	3.78e-29	129	2171	0.135	0.069	DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana OX=3702 GN=BRR2A PE=1 SV=1
19	P51979	1.95e-28	126	1187	0.117	0.109	HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HFM1 PE=1 SV=3
20	Q9FNQ1	2.75e-28	126	2157	0.112	0.057	DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana OX=3702 GN=BRR2C PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	5.3e-12	57.4	DEAD/DEAH box helicase
2	PF10391 DNA_pol_lambd_f	85	14.4	Fingers domain of DNA polymerase lambda
3	PF14229 DUF4332	13	17.4	Domain of unknown function (DUF4332)
4	PF00271 Helicase_C	1.4e-06	40.0	Helicase conserved C-terminal domain
5	PF14520 HHH_5	10	18.1	Helix-hairpin-helix domain
6	PF20470 HTH_61	4.4e-21	86.5	Helix-turn-helix domain
7	PF18312 ScsC_N	3e+02	12.5	Copper resistance protein ScsC N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295488

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000435506	0.966	DNA polymerase nu
2	9606.ENSP00000368349	0.927	DNA polymerase alpha catalytic subunit
3	9606.ENSP00000372088	0.879	DNA repair protein RAD51 homolog 1
4	9606.ENSP00000287647	0.837	Fanconi anemia group D2 protein
5	9606.ENSP00000336701	0.787	DNA repair protein RAD51 homolog 3
6	9606.ENSP00000385021	0.711	E3 ubiquitin-protein ligase FANCL
7	9606.ENSP00000351697	0.689	DNA polymerase zeta catalytic subunit
8	9606.ENSP00000343741	0.681	Serine/threonine-protein kinase ATR
9	9606.ENSP00000336741	0.672	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
10	9606.ENSP00000261593	0.671	E3 ubiquitin-protein ligase RNF138
11	9606.ENSP00000484288	0.666	DNA ligase 4
12	9606.ENSP00000419471	0.657	DNA repair protein RAD51 homolog 2
13	9606.ENSP00000303398	0.651	Mdm2-binding protein
14	9606.ENSP00000411099	0.648	Serine/threonine-protein kinase tousled-like 1
15	9606.ENSP00000263187	0.641	MutS protein homolog 4
16	9606.ENSP00000310842	0.637	Fanconi anemia group I protein
17	9606.ENSP00000355506	0.634	Exonuclease 1
18	9606.ENSP00000258962	0.632	Serine/arginine-rich splicing factor 1
19	9606.ENSP00000382628	0.628	DNA endonuclease RBBP8
20	9606.ENSP00000416739	0.627	ATP-dependent DNA helicase Q1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043138	0.999	3'-5' DNA helicase activity
GO:0017116	0.998	single-stranded DNA helicase activity
GO:1990518	0.660	single-stranded 3'-5' DNA helicase activity
GO:0003676	0.511	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:1901360	0.997	organic cyclic compound metabolic process
GO:0006281	0.990	DNA repair
GO:0006302	0.968	double-strand break repair
GO:0006310	0.947	DNA recombination
GO:0000725	0.897	recombinational repair
GO:0006303	0.833	double-strand break repair via nonhomologous end joining
GO:0000724	0.800	double-strand break repair via homologous recombination
GO:0065007	0.506	biological regulation
GO:0050789	0.466	regulation of biological process
GO:0050794	0.404	regulation of cellular process
GO:0019222	0.366	regulation of metabolic process
GO:0060255	0.324	regulation of macromolecule metabolic process
GO:0071840	0.302	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005694	0.995	chromosome
GO:0031981	0.978	nuclear lumen
GO:0005654	0.972	nucleoplasm
GO:0032991	0.916	protein-containing complex
GO:0090734	0.879	site of DNA damage
GO:0016604	0.576	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.4	0.999	DNA 3'-5' helicase.

[back to server]