StarFunc result for job id Q8TDI0

User Input

>input (1954 residues)
MRGPVGTEEELPRLFAEEMENEDEMSEEEDGGLEAFDDFFPVEPVSLPKKKKPKKLKENK
CKGKRKKKEGSNDELSENEEDLEEKSESEGSDYSPNKKKKKKLKDKKEKKAKRKKKDEDE
DDNDDGCLKEPKSSGQLMAEWGLDDVDYLFSEEDYHTLTNYKAFSQFLRPLIAKKNPKIP
MSKMMTVLGAKWREFSANNPFKGSSAAAAAAAVAAAVETVTISPPLAVSPPQVPQPVPIR
KAKTKEGKGPGVRKKIKGSKDGKKKGKGKKTAGLKFRFGGISNKRKKGSSSEEDEREESD
FDSASIHSASVRSECSAALGKKSKRRRKKKRIDDGDGYETDHQDYCEVCQQGGEIILCDT
CPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKDDDDEEEEGGCEEEEDDHMEFCR
VCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEP
PAPFMVGLPGPDVEPSLPPPKPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYR
NYQRKNDMDEPPPFDYGSGDEDGKSEKRKNKDPLYAKMEERFYRYGIKPEWMMIHRILNH
SFDKKGDVHYLIKWKDLPYDQCTWEIDDIDIPYYDNLKQAYWGHRELMLGEDTRLPKRLL
KKGKKLRDDKQEKPPDTPIVDPTVKFDKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTD
TILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTY
TGDKESRSVIRENEFSFEDNAIRSGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIE
WACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNN
LEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYY
KFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLV
KSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQ
EAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQN
KKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEEL
FKDDVEGMMSQGQRPVTPIPDVQSSKGGNLAASAKKKHGSTPPGDNKDVEDSSVIHYDDA
AISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREIIKQEENVDPDYW
EKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDED
EDFEERPEGQSGRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWG
MPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHV
LTRIGVMSLVRKKVQEFEHVNGKYSTPDLIPEGPEGKKSGEVISSDPNTPVPASPAHLLP
APLGLPDKMEAQLGYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHESPASKERAREE
RPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSRGDSSELRPDDTKAEEKEPIET
QQNGDKEEDDEGKKEDKKGKFKFMFNIADGGFTELHTLWQNEERAAVSSGKIYDIWHRRH
DYWLLAGIVTHGYARWQDIQNDPRYMILNEPFKSEVHKGNYLEMKNKFLARRFKLLEQAL
VIEEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKV
LNQLEELLSDMKADVTRLPSMLSRIPPVAARLQMSERSILSRLTNRAGDPTIQQGAFGSS
QMYSNNFGPNFRGPGPGGIVNYNQMPLGPYVTDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IJ89	0.436	0.431	0.000	1980	0.774	0.764	A0A0R4IJ89.pdb.gz
2	AFDB:A0A2R8Q3B4	0.408	0.438	0.000	1820	0.667	0.716	A0A2R8Q3B4.pdb.gz
3	AFDB:F1QWV5	0.455	0.455	0.000	1952	0.672	0.673	F1QWV5.pdb.gz
4	AFDB:Q8TDI0	1.000	1.000	0.000	1954	1.000	1.000	Q8TDI0.pdb.gz	CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens OX=9606 GN=CHD5 PE=1 SV=1
5	AFDB:Q54Q16	0.297	0.302	2.022E-66	1917	0.232	0.237	Q54Q16.pdb.gz	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
6	AFDB:F4IV99	0.311	0.350	2.268E-65	1724	0.224	0.253	F4IV99.pdb.gz	CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana OX=3702 GN=CHR5 PE=1 SV=1
7	AFDB:A0A1D8PJG4	0.248	0.367	3.212E-46	1302	0.132	0.197	A0A1D8PJG4.pdb.gz	A0A1D8PJG4_CANAL RSC chromatin remodeling complex ATPase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STH1 PE=4 SV=1
8	AFDB:P51532	0.253	0.298	8.199E-45	1647	0.183	0.217	P51532.pdb.gz	SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2
9	AFDB:P25439	0.244	0.290	1.116E-43	1638	0.176	0.209	P25439.pdb.gz	BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster OX=7227 GN=brm PE=1 SV=2
10	PDB:6g0lM	0.268	0.593	5.257E-43	855	0.133	0.304	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
11	PDB:6g0lW	0.279	0.602	1.598E-42	878	0.146	0.325	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
12	PDB:6jylK	0.227	0.857	1.639E-38	504	0.115	0.446	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
13	PDB:6tdaS	0.225	0.552	1.763E-34	783	0.110	0.273	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
14	PDB:7epuB	0.170	0.365	5.461E-33	748	0.113	0.295	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
15	PDB:7oo3b	0.215	0.737	1.394E-31	534	0.086	0.315	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
16	PDB:6uxwA	0.226	0.548	2.613E-31	778	0.111	0.279	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
17	PDB:6kw3Y	0.225	0.761	8.341E-31	548	0.112	0.400	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
18	PDB:6gejM	0.218	0.600	1.228E-30	688	0.108	0.308	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
19	PDB:5vvrM	0.201	0.703	3.605E-24	503	0.080	0.312	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
20	AFDB:Q8T145	0.171	0.186	1.013E-14	1789	0.104	0.114	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGG9	2494	1937	0.687	0.693	A0A0C4DGG9_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
2	A0A2R8Y212	2513	1914	0.686	0.701	A0A2R8Y212_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
3	A0A2R8Y425	2505	1889	0.686	0.710	A0A2R8Y425_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
4	A0A2R8Y521	2482	1920	0.684	0.696	A0A2R8Y521_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
5	A0A2R8Y5J0	2500	1892	0.684	0.707	A0A2R8Y5J0_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
6	A0A2R8Y8C1	2115	1669	0.578	0.677	A0A2R8Y8C1_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
7	A0A2R8YFD8	2511	1903	0.688	0.707	A0A2R8YFD8_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
8	A0A2R8YFK9	2501	1899	0.684	0.704	A0A2R8YFK9_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
9	A0A2U3TZM0	2496	1902	0.683	0.702	A0A2U3TZM0_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
10	A0A8I6ACF8	2471	1899	0.679	0.699	A0A8I6ACF8_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Chd4 PE=1 SV=1
11	A2A8L1	3454	1946	0.923	0.927	CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus OX=10090 GN=Chd5 PE=1 SV=1
12	B1AR17	2545	2055	0.693	0.659	B1AR17_MOUSE DNA helicase OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
13	D3ZD32	3554	1948	0.948	0.951	CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Chd5 PE=1 SV=1
14	E9PU01	2501	1928	0.684	0.693	E9PU01_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Chd4 PE=1 SV=4
15	E9Q614	2545	2021	0.691	0.668	E9Q614_MOUSE DNA helicase OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
16	F5GWX5	2510	1905	0.687	0.704	F5GWX5_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
17	F7C528	2548	1886	0.691	0.716	F7C528_MOUSE DNA helicase (Fragment) OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
18	G5EBZ4	1402	1829	0.385	0.411	LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans OX=6239 GN=let-418 PE=1 SV=1
19	O16102	1005	892	0.259	0.567	CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster OX=7227 GN=Chd3 PE=1 SV=3
20	O97159	1550	1982	0.426	0.420	CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster OX=7227 GN=Mi-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	4.6e+02	12.5	AAA domain
2	PF08074 CHDCT2	2.6e-75	262.8	CHDCT2 (NUC038) domain
3	PF06461 CHDII_SANT-like	4.1e-58	206.6	CHD subfamily II, SANT-like domain
4	PF08073 CHDNT	1.8e-21	87.1	CHDNT (NUC034) domain
5	PF00385 Chromo	6.7e-14	62.9	Chromo (CHRromatin Organisation MOdifier) domain
6	PF06465 DUF1087	2.2e-21	87.0	CHD subfamily II, DUF1087
7	PF11496 HDA2-3	0.34	21.6	Class II histone deacetylase complex subunits 2 and 3
8	PF00271 Helicase_C	7.8e-18	76.2	Helicase conserved C-terminal domain
9	PF00628 PHD	5.2e-18	76.0	PHD-finger
10	PF13831 PHD_2	38	15.1	PHD-finger
11	PF04851 ResIII	0.00017	33.1	Type III restriction enzyme, res subunit
12	PF00176 SNF2-rel_dom	9.8e-62	220.3	SNF2-related domain
13	PF15446 zf-PHD-like	4.9e+02	11.7	PHD/FYVE-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262450

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.983	Histone deacetylase 1
2	9606.ENSP00000369424	0.979	Histone-binding protein RBBP7
3	9606.ENSP00000333633	0.976	Metastasis-associated protein MTA1
4	9606.ENSP00000353463	0.967	Transcriptional repressor p66-alpha
5	9606.ENSP00000430432	0.967	Histone deacetylase 2
6	9606.ENSP00000278823	0.962	Metastasis-associated protein MTA2
7	9606.ENSP00000357644	0.953	Transcriptional repressor p66-beta
8	9606.ENSP00000412302	0.927	Methyl-CpG-binding domain protein 3
9	9606.ENSP00000362592	0.917	Histone-binding protein RBBP4
10	9606.ENSP00000383973	0.888	Metastasis-associated protein MTA3
11	9606.ENSP00000349508	0.872	Chromodomain-helicase-DNA-binding protein 4
12	9606.ENSP00000369716	0.791	Chromodomain-helicase-DNA-binding protein 3
13	9606.ENSP00000354206	0.787	Zinc finger protein 219
14	9606.ENSP00000307208	0.777	Nucleosome-remodeling factor subunit BPTF
15	9606.ENSP00000217244	0.772	Casein kinase II subunit alpha
16	9606.ENSP00000387822	0.715	Bromodomain testis-specific protein
17	9606.ENSP00000336842	0.658	Actin-related protein 8
18	9606.ENSP00000256429	0.645	Methyl-CpG-binding domain protein 2
19	9606.ENSP00000362578	0.629	E3 ubiquitin-protein ligase RNF8
20	9606.ENSP00000366221	0.628	Zinc finger protein castor homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0035064	0.991	methylated histone binding
GO:0061628	0.789	H3K27me3 modified histone binding
GO:0003824	0.784	catalytic activity
GO:0003682	0.709	chromatin binding
GO:0003677	0.547	DNA binding
GO:0008094	0.345	ATP-dependent activity, acting on DNA
GO:0016787	0.303	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.969	regulation of cellular process
GO:0031323	0.909	regulation of cellular metabolic process
GO:0080090	0.908	regulation of primary metabolic process
GO:0051171	0.908	regulation of nitrogen compound metabolic process
GO:0060255	0.890	regulation of macromolecule metabolic process
GO:0071704	0.864	organic substance metabolic process
GO:0010468	0.859	regulation of gene expression
GO:0044238	0.848	primary metabolic process
GO:0006807	0.828	nitrogen compound metabolic process
GO:0019219	0.822	regulation of nucleobase-containing compound metabolic process
GO:0043170	0.809	macromolecule metabolic process
GO:0009889	0.749	regulation of biosynthetic process
GO:0071840	0.691	cellular component organization or biogenesis
GO:0016570	0.685	histone modification
GO:0016043	0.650	cellular component organization
GO:0006355	0.615	regulation of DNA-templated transcription
GO:0006325	0.598	chromatin organization
GO:0006338	0.491	chromatin remodeling
GO:0048519	0.449	negative regulation of biological process
GO:0048523	0.429	negative regulation of cellular process
GO:0044237	0.393	cellular metabolic process
GO:0006357	0.380	regulation of transcription by RNA polymerase II
GO:0048856	0.329	anatomical structure development
GO:0010605	0.303	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005694	0.964	chromosome
GO:0000785	0.953	chromatin
GO:0032991	0.935	protein-containing complex
GO:0140513	0.725	nuclear protein-containing complex
GO:1902494	0.704	catalytic complex
GO:0070603	0.488	SWI/SNF superfamily-type complex
GO:0005737	0.462	cytoplasm
GO:0016607	0.367	nuclear speck
GO:0005667	0.364	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.303	Hydrolases.

[back to server]