StarFunc result for job id Q8TDI8

User Input

>input (760 residues)
MSPKKVQIKVEEKEDETEESSSEEEEEVEDKLPRRESLRPKRKRTRDVINEDDPEPEPED
EETRKAREKERRRRLKRGAEEEEIDEEELERLKAELDEKRQIIATVKCKPWKMEKKIEVL
KEAKKFVSENEGALGKGKGKRWFAFKMMMAKKWAKFLRDFENFKAACVPWENKIKAIESQ
FGSSVASYFLFLRWMYGVNMVLFILTFSLIMLPEYLWGLPYGSLPRKTVPRAEEASAANF
GVLYDFNGLAQYSVLFYGYYDNKRTIGWMNFRLPLSYFLVGIMCIGYSFLVVLKAMTKNI
GDDGGGDDNTFNFSWKVFTSWDYLIGNPETADNKFNSITMNFKEAITEEKAAQVEENVHL
IRFLRFLANFFVFLTLGGSGYLIFWAVKRSQEFAQQDPDTLGWWEKNEMNMVMSLLGMFC
PTLFDLFAELEDYHPLIALKWLLGRIFALLLGNLYVFILALMDEINNKIEEEKLVKANIT
LWEANMIKAYNASFSENSTGPPFFVHPADVPRGPCWETMVGQEFVRLTVSDVLTTYVTIL
IGDFLRACFVRFCNYCWCWDLEYGYPSYTEFDISGNVLALIFNQGMIWMGSFFAPSLPGI
NILRLHTSMYFQCWAVMCCNVPEARVFKASRSNNFYLGMLLLILFLSTMPVLYMIVSLPP
SFDCGPFSGKNRMFEVIGETLEHDFPSWMAKILRQLSNPGLVIAVILVMVLAIYYLNATA
KGQKAANLDLKKKMKMQALENKMRNKKMAAARAAAAAGRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R4P5	0.913	0.916	4.970E-93	757	0.958	0.962	Q8R4P5.pdb.gz	TMC1_MOUSE Transmembrane channel-like protein 1 OS=Mus musculus OX=10090 GN=Tmc1 PE=1 SV=1
2	AFDB:A4FUA6	0.758	0.778	1.868E-84	740	0.908	0.932	A4FUA6.pdb.gz	A4FUA6_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
3	AFDB:F1QZE9	0.819	0.702	1.189E-67	892	0.545	0.464	F1QZE9.pdb.gz	TMC2B_DANRE Transmembrane channel-like protein 2-B OS=Danio rerio OX=7955 GN=tmc2b PE=2 SV=2
4	AFDB:F1QFU0	0.774	0.635	3.148E-67	935	0.599	0.487	F1QFU0.pdb.gz	TMC1_DANRE Transmembrane channel-like protein 1 OS=Danio rerio OX=7955 GN=tmc1 PE=1 SV=2
5	AFDB:E7FFT2	0.795	0.664	6.979E-66	916	0.558	0.463	E7FFT2.pdb.gz	TMC2A_DANRE Transmembrane channel-like protein 2-A OS=Danio rerio OX=7955 GN=tmc2a PE=1 SV=2
6	AFDB:Q8TDI7	0.774	0.654	7.625E-66	906	0.568	0.477	Q8TDI7.pdb.gz	TMC2_HUMAN Transmembrane channel-like protein 2 OS=Homo sapiens OX=9606 GN=TMC2 PE=2 SV=3
7	AFDB:Q8R4P4	0.775	0.667	9.103E-66	888	0.559	0.479	Q8R4P4.pdb.gz	TMC2_MOUSE Transmembrane channel-like protein 2 OS=Mus musculus OX=10090 GN=Tmc2 PE=1 SV=1
8	AFDB:D3KZG3	0.759	0.458	7.518E-40	1285	0.320	0.189	D3KZG3.pdb.gz	TMC1_CAEEL Transmembrane channel-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=tmc-1 PE=1 SV=2
9	PDB:7uswA	0.625	0.763	9.653E-38	608	0.305	0.382	7uswA.pdb.gz	Structures of the TMC-1 complex illuminate mechanosensory transduction.
10	AFDB:A0A0U1QT59	0.722	0.286	2.704E-32	2036	0.343	0.128	A0A0U1QT59.pdb.gz	TMC_DROME Transmembrane channel-like protein OS=Drosophila melanogaster OX=7227 GN=Tmc PE=1 SV=1
11	AFDB:Q7Z404	0.565	0.600	1.270E-26	712	0.213	0.228	Q7Z404.pdb.gz	TMC4_HUMAN Transmembrane channel-like protein 4 OS=Homo sapiens OX=9606 GN=TMC4 PE=1 SV=3
12	PDB:8b8jA	0.317	0.336	5.102E-5	709	0.079	0.085	8b8jA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
13	PDB:7zk3A	0.328	0.344	1.293E-4	721	0.067	0.071	7zk3A.pdb.gz	Inhibition mechanism of the chloride channel TMEM16A by the pore blocker 1PBC.
14	PDB:8b8kA	0.309	0.315	1.412E-4	741	0.076	0.078	8b8kA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
15	PDB:8bc1A	0.279	0.378	1.762E-4	527	0.076	0.110	8bc1A.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
16	PDB:7rxgB	0.297	0.337	9.476E-4	650	0.088	0.103	7rxgB.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.
17	PDB:8b8mB	0.300	0.330	9.476E-4	682	0.072	0.081	8b8mB.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
18	PDB:8bc0B	0.292	0.342	1.292E-3	636	0.068	0.082	8bc0B.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
19	PDB:6p47A	0.288	0.300	2.623E-3	725	0.071	0.074	6p47A.pdb.gz
20	PDB:6qm5A	0.299	0.332	2.996E-3	673	0.104	0.117	6qm5A.pdb.gz	Stepwise activation mechanism of the scramblase nhTMEM16 revealed by cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KB87	0.0	1337	659	0.847	0.977	A0A0G2KB87_RAT Transmembrane channel-like protein OS=Rattus norvegicus OX=10116 GN=Tmc1 PE=3 SV=2
2	A4FU59	0.0	960	554	0.676	0.928	A4FU59_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
3	A4FUA6	0.0	1247	740	0.874	0.897	A4FUA6_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
4	A5D8Y1	0.0	1247	739	0.874	0.899	A5D8Y1_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
5	E7FFT2	0.0	875	916	0.551	0.457	TMC2A_DANRE Transmembrane channel-like protein 2-A OS=Danio rerio OX=7955 GN=tmc2a PE=1 SV=2
6	F1QFU0	0.0	944	935	0.576	0.468	TMC1_DANRE Transmembrane channel-like protein 1 OS=Danio rerio OX=7955 GN=tmc1 PE=1 SV=2
7	F1QZE9	0.0	845	892	0.571	0.487	TMC2B_DANRE Transmembrane channel-like protein 2-B OS=Danio rerio OX=7955 GN=tmc2b PE=2 SV=2
8	Q3MI88	0.0	1276	727	0.904	0.945	Q3MI88_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
9	Q8R4P4	0.0	884	888	0.571	0.489	TMC2_MOUSE Transmembrane channel-like protein 2 OS=Mus musculus OX=10090 GN=Tmc2 PE=1 SV=1
10	Q8R4P5	0.0	1493	757	0.958	0.962	TMC1_MOUSE Transmembrane channel-like protein 1 OS=Mus musculus OX=10090 GN=Tmc1 PE=1 SV=1
11	Q8TDI7	0.0	888	906	0.579	0.486	TMC2_HUMAN Transmembrane channel-like protein 2 OS=Homo sapiens OX=9606 GN=TMC2 PE=2 SV=3
12	Q8C5T3	5.24e-100	306	152	0.196	0.980	Q8C5T3_MOUSE Transmembrane channel-like protein OS=Mus musculus OX=10090 GN=Tmc1 PE=2 SV=1
13	A0A0U1QT59	5.03e-72	259	2036	0.187	0.070	TMC_DROME Transmembrane channel-like protein OS=Drosophila melanogaster OX=7227 GN=Tmc PE=1 SV=1
14	Q8CCC1	7.43e-70	227	131	0.155	0.901	Q8CCC1_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Tmc1 PE=2 SV=1
15	D3KZG3	1.23e-65	239	1285	0.186	0.110	TMC1_CAEEL Transmembrane channel-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=tmc-1 PE=1 SV=2
16	E7FDU7	1.22e-35	146	685	0.197	0.219	E7FDU7_DANRE Transmembrane channel-like protein OS=Danio rerio OX=7955 GN=si:dkey-202l16.5 PE=3 SV=1
17	Q7Z404	3.38e-31	132	712	0.233	0.249	TMC4_HUMAN Transmembrane channel-like protein 4 OS=Homo sapiens OX=9606 GN=TMC4 PE=1 SV=3
18	Q6UXY8	2.22e-30	130	1006	0.170	0.128	TMC5_HUMAN Transmembrane channel-like protein 5 OS=Homo sapiens OX=9606 GN=TMC5 PE=2 SV=3
19	Q8IU68	3.42e-26	117	726	0.196	0.205	TMC8_HUMAN Transmembrane channel-like protein 8 OS=Homo sapiens OX=9606 GN=TMC8 PE=1 SV=1
20	Q7Z403	1.62e-17	89.7	805	0.095	0.089	TMC6_HUMAN Transmembrane channel-like protein 6 OS=Homo sapiens OX=9606 GN=TMC6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05814 Ac76	3.3e+02	12.7	Orf76 (Ac76)
2	PF07810 TMC	2.6e-31	119.8	TMC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297784

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363068	0.989	Protocadherin-15
2	9606.ENSP00000324775	0.954	Transmembrane inner ear expressed protein
3	9606.ENSP00000353346	0.954	LHFPL tetraspan subfamily member 5 protein
4	9606.ENSP00000205890	0.846	Unconventional myosin-XV
5	9606.ENSP00000258930	0.823	Calcium and integrin-binding family member 2
6	9606.ENSP00000291532	0.822	Transmembrane protease serine 3
7	9606.ENSP00000272371	0.819	Otoferlin
8	9606.ENSP00000265944	0.818	Myosin-IIIa
9	9606.ENSP00000381768	0.818	Cadherin-23
10	9606.ENSP00000376472	0.785	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
11	9606.ENSP00000300591	0.780	Lipoxygenase homology domain-containing protein 1
12	9606.ENSP00000386331	0.775	Unconventional myosin-VIIa
13	9606.ENSP00000438262	0.766	Tight junction protein ZO-2
14	9606.ENSP00000257515	0.764	Protein FAM189A2
15	9606.ENSP00000265715	0.762	Pendrin
16	9606.ENSP00000372295	0.760	Gap junction beta-2 protein
17	9606.ENSP00000386647	0.745	Pejvakin
18	9606.ENSP00000384312	0.738	TRIO and F-actin-binding protein
19	9606.ENSP00000005226	0.734	Harmonin
20	9606.ENSP00000379563	0.731	Translocator protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008381	1.000	mechanosensitive monoatomic ion channel activity
GO:0005245	1.000	voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009582	0.997	detection of abiotic stimulus
GO:0009581	0.997	detection of external stimulus
GO:0007600	0.997	sensory perception
GO:0050974	0.993	detection of mechanical stimulus involved in sensory perception
GO:0050910	0.976	detection of mechanical stimulus involved in sensory perception of sound
GO:0009987	0.743	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.955	organelle
GO:0043227	0.754	membrane-bounded organelle
GO:0120025	0.702	plasma membrane bounded cell projection
GO:0005622	0.669	intracellular anatomical structure
GO:0043005	0.664	neuron projection
GO:0005737	0.586	cytoplasm
GO:0098858	0.548	actin-based cell projection
GO:0043231	0.421	intracellular membrane-bounded organelle
GO:0098862	0.346	cluster of actin-based cell projections
GO:0032421	0.307	stereocilium bundle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]