StarFunc result for job id Q8TDJ6

User Input

>input (1400 residues)
MHLHQVLTGAVNPGDNCYSVGSVGDVPFTAYGSGCDIVILANDFECVQIIPGAKHGNIQV
SCVECSNQQGRIAASYGNAVCIFEPLGINSHKRNCQLKCQWLKTGQFFLSSVTYNLAWDP
QDNRLLTATDSIQLWAPPGDDILEEEEEIDNTVPPVLNDWKCVWQCKTSVSVHLMEWSPD
GEYFATAGKDDCLLKVWYPMTGWKSSIIPQDHHEVKRRQSSTQFSFVYLAHPRAVTGFSW
RKTSKYMPRGSVCNVLLTSCHDGVCRLWAETLLPEDCLLGEQICETTTSSIASSLSHAGR
HKDRIQHALETIHHLKNLRKGQRRSSVLVTHAELMPDQTAMHEVQRHISHHANALCHFHI
AASINPATDIPNVLVGTAFNVDDGNGGFVVHWLNNKEFHFTSSTEVFMHQLRKLSDKQVD
HENDDADREDEEHSQEDRERGLHMKLDHDLSLDRESEAGTGSSEHEDGEREGSPRTYSRL
SVPMPLPTVLLDRKIETLLTEWNKNPDMLFTIHPVDGTFLVWHVKYLDEYNPGIFRQVQV
SFSSRIPVAFPSGDASSLSKNIMMYACINATKDSHHTLLHQEGMSVGSPHGSQPHSRSHS
THMNILAPTVMMISKHIDGSLNQWAVTFADKSAFTTVLTVSHKFRYCGHRFHLNDLACHS
VLPLLLTSSHHNALLTPELDCQWDSDNKLSRLMDPVKHIKGSSKQPLRNAATRTFHDPNA
IYSELILWRVDPIGPLSYTGGVSELARINSLHTSAFSNVAWLPTLIPSYCLGTYCNSASA
CFVASDGKNLRLYQAVVDARKLLDELSDPESSKLIGEVFNIVSQQSTARPGCIIELDAIT
NQCGSNTQLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKD
SNNNSILHMWHLHLKSVQACLAKASEGASSESLLSVPGQKNVDSSPETSPSVSPMPHSSS
IANLQTASKLILSSRLVYSQPLDLPESVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCS
DNKVRFWKCCMEANPECNKSDEKEIYHWKRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTG
RLAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEWVLEQTIHLDDLVKVGSVLDSRVS
VDSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGI
VTEQTNSKDGVAVITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGIL
VVGMDCEMHVYAQWKHAVKFGDTEADSSNAEEAAMQDHSTFKSNMLARKSVVEGTAISDD
VFCSPTVIQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVA
IVRDPDAGEGTKRHLSRTIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5m2nA	0.301	0.522	2.809E-15	711	0.084	0.165	5m2nA.pdb.gz
2	PDB:6qk7B	0.305	0.502	2.291E-14	749	0.086	0.162	6qk7B.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
3	PDB:6jp6A	0.129	0.160	2.389E-12	998	0.083	0.116	6jp6A.pdb.gz
4	PDB:7mq8LO	0.223	0.334	2.764E-11	848	0.088	0.145	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:7mqaLO	0.155	0.236	1.756E-10	819	0.079	0.134	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:7mqaLQ	0.183	0.277	4.771E-10	830	0.076	0.129	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
7	PDB:7dvq3	0.124	0.142	9.135E-10	1193	0.098	0.115	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
8	PDB:7d5sBE	0.220	0.328	1.363E-9	865	0.067	0.109	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
9	AFDB:Q4GYD0	0.123	0.117	1.466E-9	1484	0.103	0.097	Q4GYD0.pdb.gz	Q4GYD0_TRYB2 Minichromosome loss protein Mcl1 middle region domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4480 PE=4 SV=1
10	PDB:7mq8LT	0.214	0.316	2.482E-9	869	0.075	0.121	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:6tblF	0.122	0.405	3.701E-9	336	0.035	0.146	6tblF.pdb.gz
12	AFDB:P59328	0.113	0.139	1.460E-8	1117	0.064	0.080	P59328.pdb.gz	WDHD1_MOUSE WD repeat and HMG-box DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Wdhd1 PE=1 SV=2
13	AFDB:O75717	0.114	0.136	6.874E-8	1129	0.104	0.128	O75717.pdb.gz	WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1
14	AFDB:Q229Z6	0.132	0.257	1.252E-7	634	0.050	0.110	Q229Z6.pdb.gz	POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_01308010 PE=3 SV=1
15	AFDB:F8W3V6	0.123	0.143	3.401E-7	1193	0.065	0.076	F8W3V6.pdb.gz
16	AFDB:Q9D0N7	0.096	0.223	2.272E-6	572	0.026	0.065	Q9D0N7.pdb.gz	CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus OX=10090 GN=Chaf1b PE=1 SV=1
17	AFDB:F1QAL1	0.117	0.229	1.517E-5	677	0.064	0.133	F1QAL1.pdb.gz	F1QAL1_DANRE NEDD1 gamma-tubulin ring complex targeting factor OS=Danio rerio OX=7955 GN=fb78g03 PE=1 SV=3
18	AFDB:H2LP95	0.111	0.143	3.548E-5	1067	0.029	0.038	H2LP95.pdb.gz	TBC31_ORYLA TBC1 domain family member 31 OS=Oryzias latipes OX=8090 GN=tbc1d31 PE=3 SV=2
19	AFDB:Q6P7E1	0.114	0.149	4.121E-5	968	0.057	0.083	Q6P7E1.pdb.gz	Q6P7E1_DANRE Semaphorin-6A precursor OS=Danio rerio OX=7955 GN=zgc:66106 PE=2 SV=1
20	AFDB:O13856	0.152	0.481	1.013E-4	361	0.039	0.150	O13856.pdb.gz	YEX2_SCHPO Uncharacterized WD repeat-containing protein C1A6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1A6.02 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZMW1	0.0	2642	3035	0.921	0.425	A0A8I5ZMW1_RAT Dmx-like 2 OS=Rattus norvegicus OX=10116 GN=Dmxl2 PE=1 SV=1
2	B2RWN7	0.0	1479	3048	0.562	0.258	B2RWN7_HUMAN DMXL1 protein OS=Homo sapiens OX=9606 GN=DMXL1 PE=1 SV=1
3	F1M3W5	0.0	2642	3056	0.921	0.422	F1M3W5_RAT Dmx-like 2 OS=Rattus norvegicus OX=10116 GN=Dmxl2 PE=1 SV=3
4	Q8BPN8	0.0	2665	3032	0.922	0.426	DMXL2_MOUSE DmX-like protein 2 OS=Mus musculus OX=10090 GN=Dmxl2 PE=1 SV=3
5	Q8TDJ6	0.0	2925	3036	1.000	0.461	DMXL2_HUMAN DmX-like protein 2 OS=Homo sapiens OX=9606 GN=DMXL2 PE=1 SV=2
6	U5U756	0.0	1910	3050	0.692	0.318	U5U756_DANRE DmX-like protein 2 OS=Danio rerio OX=7955 GN=Rbcn3a PE=1 SV=1
7	Q9W425	5.96e-134	460	3426	0.217	0.089	Q9W425_DROME Rabconnectin-3A OS=Drosophila melanogaster OX=7227 GN=Rbcn-3A PE=1 SV=3
8	Q24593	3.82e-133	458	3429	0.217	0.089	Q24593_DROME Uncharacterized protein DmX OS=Drosophila melanogaster OX=7227 GN=Rbcn-3A PE=4 SV=1
9	P47104	5.96e-11	70.1	1357	0.043	0.044	RAV1_YEAST Regulator of V-ATPase in vacuolar membrane protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAV1 PE=1 SV=1
10	A0A0A0MRH0	0.36	37.4	443	0.020	0.063	A0A0A0MRH0_HUMAN Notchless protein homolog 1 OS=Homo sapiens OX=9606 GN=NLE1 PE=1 SV=1
11	Q9NVX2	0.41	37.4	485	0.020	0.058	NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens OX=9606 GN=NLE1 PE=1 SV=4
12	Q8VEJ4	0.60	37.0	485	0.019	0.056	NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus OX=10090 GN=Nle1 PE=1 SV=4
13	G3XD14	1.3	34.3	148	0.019	0.176	G3XD14_PSEAE RNA polymerase-binding transcription factor DksA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=dksA PE=3 SV=1
14	Q9KKG5	1.3	34.3	148	0.019	0.176	Q9KKG5_PSEAI RNA polymerase-binding transcription factor DksA OS=Pseudomonas aeruginosa OX=287 GN=dksA PE=3 SV=1
15	K7EN33	1.8	35.0	304	0.009	0.043	K7EN33_HUMAN Notchless homolog 1 (Fragment) OS=Homo sapiens OX=9606 GN=NLE1 PE=1 SV=1
16	P25382	2.4	35.0	515	0.024	0.064	NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSA4 PE=1 SV=3
17	A0QQC8	2.5	35.0	622	0.024	0.053	DNAK_MYCS2 Chaperone protein DnaK OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=dnaK PE=1 SV=1
18	Q5APF0	3.0	34.7	466	0.016	0.049	YTM1_CANAL Ribosome biogenesis protein YTM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YTM1 PE=3 SV=1
19	Q6LA54	5.2	33.9	933	0.021	0.032	YF48_SCHPO Uncharacterized WD repeat-containing protein C3H5.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H5.08c PE=1 SV=2
20	E9PZP8	5.4	34.3	4859	0.022	0.006	E9PZP8_MOUSE HECT and RLD domain containing E3 ubiquitin protein ligase family member 1 OS=Mus musculus OX=10090 GN=Herc1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04361 DUF494	6.2e+02	11.7	Protein of unknown function (DUF494)
2	PF08662 eIF2A	81	14.5	Eukaryotic translation initiation factor eIF2A
3	PF01160 Opiods_neuropep	9.6e+02	11.3	Vertebrate endogenous opioids neuropeptide
4	PF12234 Rav1p_C	1.5e-05	35.3	RAVE protein 1 C terminal
5	PF00400 WD40	0.025	26.6	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441858

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254442	0.972	WD repeat-containing protein 7
2	9606.ENSP00000310933	0.947	MAP kinase-activating death domain protein
3	9606.ENSP00000351832	0.921	Rab3 GTPase-activating protein non-catalytic subunit
4	9606.ENSP00000231487	0.892	S-phase kinase-associated protein 1
5	9606.ENSP00000411418	0.888	Rab3 GTPase-activating protein catalytic subunit
6	9606.ENSP00000322832	0.876	Protein rogdi homolog
7	9606.ENSP00000267838	0.763	LysM and putative peptidoglycan-binding domain-containing protein 2
8	9606.ENSP00000430774	0.731	Uncharacterized protein
9	9606.ENSP00000273398	0.709	V-type proton ATPase catalytic subunit A
10	9606.ENSP00000222256	0.683	Ras-related protein Rab-3A
11	9606.ENSP00000261842	0.681	AP-4 complex subunit epsilon-1
12	9606.ENSP00000308753	0.668	Tropomodulin-3
13	9606.ENSP00000234396	0.645	V-type proton ATPase subunit B, kidney isoform
14	9606.ENSP00000276390	0.634	V-type proton ATPase subunit B, brain isoform
15	9606.ENSP00000377250	0.632	Protein MON2 homolog
16	9606.ENSP00000328016	0.621	Tumor necrosis factor alpha-induced protein 8-like protein 3
17	9606.ENSP00000308122	0.620	V-type proton ATPase 116 kDa subunit a isoform 4
18	9606.ENSP00000277942	0.611	Neuropeptide FF receptor 1
19	9606.ENSP00000361918	0.605	Peptidyl-prolyl cis-trans isomerase E
20	9606.ENSP00000264649	0.604	V-type proton ATPase 116 kDa subunit a isoform 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	0.999	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.967	cellular process
GO:0065007	0.879	biological regulation
GO:0048856	0.869	anatomical structure development
GO:0050789	0.866	regulation of biological process
GO:0048513	0.854	animal organ development
GO:0050794	0.844	regulation of cellular process
GO:0001667	0.776	ameboidal-type cell migration
GO:0048468	0.776	cell development
GO:0048522	0.762	positive regulation of cellular process
GO:0034765	0.634	regulation of monoatomic ion transmembrane transport
GO:0090263	0.632	positive regulation of canonical Wnt signaling pathway
GO:0007154	0.595	cell communication
GO:0032501	0.587	multicellular organismal process
GO:0007275	0.473	multicellular organism development
GO:1904062	0.443	regulation of monoatomic cation transmembrane transport
GO:0048731	0.401	system development
GO:0007399	0.331	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0099503	1.000	secretory vesicle
GO:0070382	0.842	exocytic vesicle
GO:0008021	0.831	synaptic vesicle
GO:0005634	0.467	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]