StarFunc result for job id Q8TDM6

User Input

>input (1919 residues)
MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLKLL
LAKERDHFQDLRAALEKTQPHLLPILYLNGVVGPPQPAEGAGSTYSVLSTMPSDSESSSS
LSSVGTTGKAPSPPPLLTDQQVNEKVENLSIQLRLMTRERNELRKRLAFATHGTAFDKRP
YHRLNPDYERLKIQCVRAMSDLQSLQNQHTNALKRCEEVAKETDFYHTLHSRLLSDQTRL
KDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKEIGDLRAQQQQVLKHNGSSEILN
KLYDTAMDKLEVVKKDYDALRKRYSEKVAIHNADLSRLEQLGEENQRLLKQTEMLTQQRD
TAIQLQHQCALSLRRFEAIHHELNKATAQNKDLQWEMELLQSELTELRTTQVKTAKESEK
YREERDAVYSEYKLIMSERDQVISELDKLQTEVELAESKLKSSTSEKKAANEEMEALRQI
KDTVTMDAGRANKEVEILRKQCKALCQELKEALQEADVAKCRRDWAFQERDKIVAERDSI
RTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLM
AHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALGFDMAEGVNEPCFPGDCGIFVTKVD
KGSIADGRLRVNDWLLRINDVDLINKDKKQAIKALLNGEGAINMVVRRRKSLGGKVVTPL
HINLSGQKDSGISLENGVYAAAVLPGSPAAKEGSLAVGDRIVAINGIALDNKSLNECESL
LRSCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDKMLSFRAHGPEVQAHNKRNLIQHNN
STQTDIFYTDRLEDRKEPGPPGGSSSFLHKPFPGGPLQVCPQACPSASERSLSSFRSDAS
GDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEK
LSVYKKPKQRKSIFDPNTFKRPQTPPKIDYLLPGPGPAHSPQPSKRAGPLTPPKPPRRSD
SIKFQHRLETSSESEATLVGSSPSTSPPSALPPDVDPGEPMHASPPRKARVRIASSYYPE
GDGDSSHLPAKKSCDEDLTSQKVDELGQKRRRPKSAPSFRPKLAPVVIPAQFLEEQKCVP
ASGELSPELQEWAPYSPGHSSRHSNPPLYPSRPSVGTVPRSLTPSTTVSSILRNPIYTVR
SHRVGPCSSPPAARDAGPQGLHPSVQHQGRLSLDLSHRTCSDYSEMRATHGSNSLPSSAR
LGSSSNLQFKAERIKIPSTPRYPRSVVGSERGSVSHSECSTPPQSPLNIDTLSSCSQSQT
SASTLPRIAVNPASLGERRKDRPYVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTVG
SIAHQAGLEYGDQLLEFNGINLRSATEQQARLIIGQQCDTITILAQYNPHVHQLSSHSRS
SSHLDPAGTHSTLQGSGTTTPEHPSVIDPLMEQDEGPSTPPAKQSSSRIAGDANKKTLEP
RVVFIKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLILEYGSLDVRNKTV
EEVYVEMLKPRDGVRLKVQYRPEEFTKAKGLPGDSFYIRALYDRLADVEQELSFKKDDIL
YVDDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNSATKTL
SAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSIPLFEDSVSLAYQRVQKVDCTALR
PVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDV
TTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDK
VTQRHSKEQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q9R9	0.336	0.336	0.000	1921	0.920	0.919	E9Q9R9.pdb.gz	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
2	AFDB:Q9VKG8	0.200	0.200	2.974E-79	1916	0.256	0.257	Q9VKG8.pdb.gz	Q9VKG8_DROME Discs large 5, isoform A OS=Drosophila melanogaster OX=7227 GN=Dlg5 PE=1 SV=1
3	PDB:2xkxA	0.131	0.294	2.952E-31	721	0.084	0.223	2xkxA.pdb.gz
4	AFDB:A0A0B4K6Y7	0.159	0.129	5.898E-24	2395	0.115	0.092	A0A0B4K6Y7.pdb.gz	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
5	AFDB:A0A2R8QMK9	0.154	0.174	4.768E-22	1689	0.094	0.107	A0A2R8QMK9.pdb.gz
6	AFDB:A0A1D5NS76	0.168	0.162	1.787E-20	2005	0.093	0.089	A0A1D5NS76.pdb.gz
7	AFDB:Q14005	0.059	0.079	4.801E-20	1332	0.106	0.152	Q14005.pdb.gz	IL16_HUMAN Pro-interleukin-16 OS=Homo sapiens OX=9606 GN=IL16 PE=1 SV=4
8	AFDB:O54824	0.056	0.072	8.783E-20	1322	0.101	0.146	O54824.pdb.gz	IL16_MOUSE Pro-interleukin-16 OS=Mus musculus OX=10090 GN=Il16 PE=1 SV=3
9	AFDB:O97758	0.159	0.171	1.098E-18	1769	0.085	0.093	O97758.pdb.gz	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
10	AFDB:Q9EQJ9	0.053	0.065	5.567E-9	1476	0.066	0.086	Q9EQJ9.pdb.gz	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
11	PDB:4f4jA	0.079	0.651	4.695E-8	189	0.018	0.185	4f4jA.pdb.gz
12	AFDB:A2ALU4	0.046	0.057	5.902E-8	1481	0.104	0.135	A2ALU4.pdb.gz	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
13	PDB:1lvgA	0.077	0.587	4.459E-7	190	0.018	0.179	1lvgA.pdb.gz	Structural characterization of the closed conformation of mouse guanylate kinase.
14	PDB:6nuiA	0.079	0.623	5.868E-7	198	0.017	0.162	6nuiA.pdb.gz
15	PDB:7mixC	0.095	0.361	1.016E-6	324	0.028	0.164	7mixC.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
16	PDB:1z6gA	0.073	0.574	1.074E-6	191	0.018	0.178	1z6gA.pdb.gz
17	PDB:2anbA	0.078	0.551	2.446E-6	206	0.011	0.102	2anbA.pdb.gz	Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
18	PDB:7pc3A	0.046	0.209	1.671E-5	405	0.016	0.077	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7p70A	0.042	0.191	3.230E-5	407	0.015	0.071	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
20	PDB:7qqmA	0.047	0.207	3.230E-5	413	0.013	0.061	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q9R9	0.0	3553	1921	0.921	0.920	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
2	Q8TDM6	0.0	3953	1919	1.000	1.000	DLG5_HUMAN Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5 PE=1 SV=4
3	M9PD90	6.20e-83	306	1915	0.089	0.089	M9PD90_DROME Discs large 5, isoform D OS=Drosophila melanogaster OX=7227 GN=Dlg5 PE=1 SV=1
4	Q9VKG8	6.21e-83	306	1916	0.089	0.089	Q9VKG8_DROME Discs large 5, isoform A OS=Drosophila melanogaster OX=7227 GN=Dlg5 PE=1 SV=1
5	Q12959	7.02e-54	207	904	0.094	0.199	DLG1_HUMAN Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1 PE=1 SV=2
6	Q811D0	1.49e-53	207	905	0.092	0.194	DLG1_MOUSE Disks large homolog 1 OS=Mus musculus OX=10090 GN=Dlg1 PE=1 SV=1
7	Q62696	3.73e-52	202	911	0.089	0.187	DLG1_RAT Disks large homolog 1 OS=Rattus norvegicus OX=10116 GN=Dlg1 PE=1 SV=1
8	P31016	3.25e-50	194	724	0.088	0.233	DLG4_RAT Disks large homolog 4 OS=Rattus norvegicus OX=10116 GN=Dlg4 PE=1 SV=1
9	P78352	6.87e-50	193	724	0.088	0.232	DLG4_HUMAN Disks large homolog 4 OS=Homo sapiens OX=9606 GN=DLG4 PE=1 SV=3
10	Q62108	3.70e-49	191	724	0.088	0.232	DLG4_MOUSE Disks large homolog 4 OS=Mus musculus OX=10090 GN=Dlg4 PE=1 SV=1
11	Q92796	9.28e-48	187	817	0.085	0.200	DLG3_HUMAN Disks large homolog 3 OS=Homo sapiens OX=9606 GN=DLG3 PE=1 SV=2
12	P70175	1.28e-47	187	849	0.086	0.194	DLG3_MOUSE Disks large homolog 3 OS=Mus musculus OX=10090 GN=Dlg3 PE=1 SV=1
13	P31007	1.53e-47	188	970	0.090	0.177	DLG1_DROME Disks large 1 tumor suppressor protein OS=Drosophila melanogaster OX=7227 GN=dlg1 PE=1 SV=2
14	Q62936	2.56e-47	187	849	0.086	0.194	DLG3_RAT Disks large homolog 3 OS=Rattus norvegicus OX=10116 GN=Dlg3 PE=1 SV=1
15	Q8MQQ3	3.14e-43	175	1149	0.067	0.111	Q8MQQ3_DROME LP05923p OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
16	Q9VHK1	3.36e-43	176	1735	0.067	0.074	Q9VHK1_DROME Polychaetoid, isoform J OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=4
17	Q94880	3.87e-43	176	1367	0.067	0.094	Q94880_DROME TamA OS=Drosophila melanogaster OX=7227 GN=pyd PE=2 SV=1
18	A0A0B4K6Y7	3.99e-43	176	2395	0.067	0.053	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
19	A8JQV8	4.28e-43	176	1446	0.067	0.089	A8JQV8_DROME Polychaetoid, isoform K OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
20	B7Z0U1	4.76e-43	175	1386	0.067	0.092	B7Z0U1_DROME Polychaetoid, isoform I OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16610 dbPDZ_assoc	8.3e-23	91.7	Unstructured region between two PDZ domains on Dlg5
2	PF19805 DUF6288	0.52	21.0	Family of unknown function (DUF6288)
3	PF00625 Guanylate_kin	1.3e-11	56.0	Guanylate kinase
4	PF00595 PDZ	7.5e-36	133.7	PDZ domain
5	PF13180 PDZ_2	5.6e-16	70.0	PDZ domain
6	PF17820 PDZ_6	3.8e-27	105.3	PDZ domain
7	PF02163 Peptidase_M50	1.9e-07	42.3	Peptidase family M50
8	PF00018 SH3_1	3.8e+02	12.1	SH3 domain
9	PF07653 SH3_2	2.8e+02	12.7	Variant SH3 domain
10	PF04822 Takusan	3.2e-28	108.8	Takusan

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361467

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.952	Catenin beta-1
2	9606.ENSP00000321537	0.861	Lethal(2) giant larvae protein homolog 1
3	9606.ENSP00000349486	0.856	Protein scribble homolog
4	9606.ENSP00000376333	0.853	Lethal(2) giant larvae protein homolog 2
5	9606.ENSP00000317714	0.834	Syntaxin-4
6	9606.ENSP00000240123	0.811	Vinexin
7	9606.ENSP00000200652	0.709	Solute carrier family 22 member 4
8	9606.ENSP00000356319	0.706	Kinesin-like protein KIF14
9	9606.ENSP00000300589	0.687	Nucleotide-binding oligomerization domain-containing protein 2
10	9606.ENSP00000360672	0.666	Partitioning defective 6 homolog beta
11	9606.ENSP00000364133	0.651	TGF-beta receptor type-1
12	9606.ENSP00000008938	0.649	Peptidoglycan recognition protein 1
13	9606.ENSP00000393583	0.628	Centrosomal protein of 131 kDa
14	9606.ENSP00000428182	0.614	MAGUK p55 subfamily member 2
15	9606.ENSP00000245407	0.602	Solute carrier family 22 member 5
16	9606.ENSP00000263713	0.595	Band 4.1-like protein 5
17	9606.ENSP00000264638	0.586	Contactin-associated protein 1
18	9606.ENSP00000342828	0.586	Homeobox protein Nkx-2.3
19	9606.ENSP00000376306	0.564	Citron Rho-interacting kinase
20	9606.ENSP00000411397	0.564	MAP/microtubule affinity-regulating kinase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0007163	0.992	establishment or maintenance of cell polarity
GO:0032502	0.985	developmental process
GO:0048518	0.980	positive regulation of biological process
GO:0048856	0.974	anatomical structure development
GO:0023051	0.962	regulation of signaling
GO:0010646	0.962	regulation of cell communication
GO:0048583	0.961	regulation of response to stimulus
GO:0051239	0.957	regulation of multicellular organismal process
GO:0048522	0.955	positive regulation of cellular process
GO:0009966	0.948	regulation of signal transduction
GO:0035331	0.941	negative regulation of hippo signaling
GO:0016043	0.817	cellular component organization
GO:0050896	0.722	response to stimulus
GO:0032501	0.675	multicellular organismal process
GO:0030154	0.650	cell differentiation
GO:0023052	0.637	signaling
GO:0007154	0.631	cell communication
GO:0007165	0.616	signal transduction
GO:0009888	0.550	tissue development
GO:0007275	0.531	multicellular organism development
GO:0010647	0.528	positive regulation of cell communication
GO:0048513	0.524	animal organ development
GO:0009967	0.507	positive regulation of signal transduction
GO:0051179	0.501	localization
GO:0022607	0.471	cellular component assembly
GO:0051128	0.458	regulation of cellular component organization
GO:0019222	0.386	regulation of metabolic process
GO:0048731	0.372	system development
GO:0051641	0.349	cellular localization
GO:0060255	0.336	regulation of macromolecule metabolic process
GO:0031323	0.336	regulation of cellular metabolic process
GO:0042127	0.322	regulation of cell population proliferation
GO:0030155	0.313	regulation of cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0005737	0.996	cytoplasm
GO:0005886	0.993	plasma membrane
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0043227	0.980	membrane-bounded organelle
GO:0005856	0.962	cytoskeleton
GO:0005829	0.936	cytosol
GO:0070161	0.915	anchoring junction
GO:0042995	0.885	cell projection
GO:0120025	0.875	plasma membrane bounded cell projection
GO:0015630	0.823	microtubule cytoskeleton
GO:0043231	0.782	intracellular membrane-bounded organelle
GO:0005911	0.777	cell-cell junction
GO:0045202	0.763	synapse
GO:0005912	0.714	adherens junction
GO:0005815	0.639	microtubule organizing center
GO:0098794	0.435	postsynapse
GO:0005929	0.412	cilium
GO:0098978	0.402	glutamatergic synapse
GO:0099572	0.336	postsynaptic specialization
GO:0036064	0.325	ciliary basal body
GO:0014069	0.324	postsynaptic density

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]