StarFunc result for job id Q8TDN6

User Input

>input (353 residues)
MAATKRKRRGGFAVQAKKPKRNEIDAEPPAKRHATAEEVEEEERDRIPGPVCKGKWKNKE
RILIFSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEA
KKKQDLYMWLSNSPHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDELPHYAL
LKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAALVEIGPRFVLNL
IKIFQGSFGGPTLYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTLLPH
DPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYKRQRKMKQRMDSGKTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDN6	1.000	1.000	1.559E-70	353	1.000	1.000	Q8TDN6.pdb.gz	BRX1_HUMAN Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens OX=9606 GN=BRIX1 PE=1 SV=2
2	AFDB:Q9HGL6	0.669	0.795	5.949E-39	295	0.348	0.417	Q9HGL6.pdb.gz	BRX1_SCHPO Ribosome biogenesis protein brx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brx1 PE=1 SV=1
3	AFDB:Q9C928	0.675	0.743	7.226E-38	320	0.385	0.425	Q9C928.pdb.gz	BRX12_ARATH Ribosome biogenesis protein BRX1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=BRIX1-2 PE=2 SV=1
4	AFDB:Q9LE16	0.678	0.757	8.777E-37	315	0.394	0.441	Q9LE16.pdb.gz	BRX11_ARATH Ribosome biogenesis protein BRX1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=BRIX1-1 PE=2 SV=1
5	AFDB:A0A1D8PFE1	0.667	0.803	1.614E-36	292	0.365	0.442	A0A1D8PFE1.pdb.gz	A0A1D8PFE1_CANAL Csi2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CSI2 PE=3 SV=1
6	AFDB:Q08235	0.677	0.818	1.937E-36	291	0.363	0.440	Q08235.pdb.gz	BRX1_YEAST Ribosome biogenesis protein BRX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRX1 PE=1 SV=2
7	PDB:7nacA	0.650	0.851	3.861E-35	266	0.357	0.474	7nacA.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
8	AFDB:Q388D6	0.610	0.698	1.866E-34	307	0.320	0.368	Q388D6.pdb.gz	Q388D6_TRYB2 Ribosome biogenesis protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1990 PE=3 SV=1
9	AFDB:Q9H7B2	0.472	0.540	5.285E-18	306	0.176	0.203	Q9H7B2.pdb.gz	RPF2_HUMAN Ribosome production factor 2 homolog OS=Homo sapiens OX=9606 GN=RPF2 PE=1 SV=2
10	AFDB:P53941	0.485	0.582	6.419E-17	290	0.119	0.145	P53941.pdb.gz	IMP4_YEAST U3 small nucleolar ribonucleoprotein protein IMP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMP4 PE=1 SV=1
11	AFDB:Q387E5	0.489	0.520	1.045E-16	331	0.176	0.187	Q387E5.pdb.gz	Q387E5_TRYB2 RNA processing factor 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0050 PE=4 SV=1
12	PDB:7mq8SM	0.466	0.559	4.069E-15	290	0.116	0.141	7mq8SM.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7ajtCJ	0.486	0.599	4.325E-15	282	0.108	0.135	7ajtCJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7ajuCJ	0.489	0.658	4.118E-14	256	0.105	0.145	7ajuCJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7bt6v	0.450	0.542	1.232E-13	287	0.142	0.174	7bt6v.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
16	PDB:6c0fI	0.484	0.583	2.720E-13	288	0.108	0.132	6c0fI.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
17	PDB:4xd9A	0.437	0.631	3.073E-13	236	0.099	0.148	4xd9A.pdb.gz
18	PDB:6c0fv	0.432	0.638	7.843E-11	225	0.127	0.200	6c0fv.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
19	PDB:4x6gE	0.125	0.139	4.686E-3	307	0.059	0.068	4x6gE.pdb.gz
20	PDB:7yhjE	0.118	0.181	1.320E-2	193	0.062	0.114	7yhjE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TDN6	0.0	733	353	1.000	1.000	BRX1_HUMAN Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens OX=9606 GN=BRIX1 PE=1 SV=2
2	Q08235	7.91e-90	273	291	0.357	0.433	BRX1_YEAST Ribosome biogenesis protein BRX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRX1 PE=1 SV=2
3	Q9HGL6	4.50e-88	268	295	0.348	0.417	BRX1_SCHPO Ribosome biogenesis protein brx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brx1 PE=1 SV=1
4	A0A1D8PFE1	1.51e-84	259	292	0.363	0.438	A0A1D8PFE1_CANAL Csi2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CSI2 PE=3 SV=1
5	Q9LE16	7.19e-81	251	315	0.354	0.397	BRX11_ARATH Ribosome biogenesis protein BRX1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=BRIX1-1 PE=2 SV=1
6	Q9C928	9.87e-81	251	320	0.346	0.381	BRX12_ARATH Ribosome biogenesis protein BRX1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=BRIX1-2 PE=2 SV=1
7	Q388D6	6.32e-66	212	307	0.289	0.332	Q388D6_TRYB2 Ribosome biogenesis protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1990 PE=3 SV=1
8	Q9H7B2	1.32e-05	48.5	306	0.088	0.101	RPF2_HUMAN Ribosome production factor 2 homolog OS=Homo sapiens OX=9606 GN=RPF2 PE=1 SV=2
9	Q387E5	7.42e-05	46.6	331	0.167	0.178	Q387E5_TRYB2 RNA processing factor 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0050 PE=4 SV=1
10	Q6DI25	8.99e-05	46.2	291	0.125	0.151	Q6DI25_DANRE IMP U3 small nucleolar ribonucleoprotein 4 OS=Danio rerio OX=7955 GN=zgc:86740 PE=1 SV=1
11	Q9VBY2	1.20e-04	45.8	298	0.113	0.134	Q9VBY2_DROME FI08810p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11920 PE=1 SV=1
12	Q9H9Y2	1.46e-04	45.4	349	0.139	0.140	RPF1_HUMAN Ribosome production factor 1 OS=Homo sapiens OX=9606 GN=RPF1 PE=1 SV=2
13	P53941	1.70e-04	45.1	290	0.136	0.166	IMP4_YEAST U3 small nucleolar ribonucleoprotein protein IMP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMP4 PE=1 SV=1
14	Q95SD3	2.15e-04	45.1	298	0.113	0.134	Q95SD3_DROME GM02712p OS=Drosophila melanogaster OX=7227 GN=CG11920 PE=2 SV=1
15	O13823	5.16e-04	43.5	289	0.142	0.173	IMP4_SCHPO U3 small nucleolar ribonucleoprotein protein imp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imp4 PE=3 SV=1
16	Q96G21	0.002	42.4	291	0.125	0.151	IMP4_HUMAN U3 small nucleolar ribonucleoprotein protein IMP4 OS=Homo sapiens OX=9606 GN=IMP4 PE=1 SV=1
17	E7ENR5	0.003	40.8	236	0.125	0.186	E7ENR5_HUMAN IMP U3 small nucleolar ribonucleoprotein 4 (Fragment) OS=Homo sapiens OX=9606 GN=IMP4 PE=1 SV=1
18	H0Y714	0.004	40.8	280	0.119	0.150	H0Y714_HUMAN IMP U3 small nucleolar ribonucleoprotein 4 (Fragment) OS=Homo sapiens OX=9606 GN=IMP4 PE=1 SV=1
19	Q9S826	0.018	38.9	294	0.133	0.160	Q9S826_ARATH Putative U3 small nucleolar ribonucleoprotein OS=Arabidopsis thaliana OX=3702 GN=IMP4 PE=1 SV=1
20	Q583Q6	0.030	38.1	287	0.108	0.132	Q583Q6_TRYB2 U3 small nuclear ribonucleoprotein (SnRNP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.280 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04427 Brix	1.4e-35	134.7	Brix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338862

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407323	0.999	Probable rRNA-processing protein EBP2
2	9606.ENSP00000261015	0.997	Ribosome biogenesis protein WDR12
3	9606.ENSP00000285814	0.997	Nucleolar protein interacting with the FHA domain of MKI67
4	9606.ENSP00000254940	0.995	60S ribosome subunit biogenesis protein NIP7 homolog
5	9606.ENSP00000360412	0.994	Nucleolar complex protein 3 homolog
6	9606.ENSP00000346725	0.993	Pescadillo homolog
7	9606.ENSP00000353246	0.992	Protein MAK16 homolog
8	9606.ENSP00000455106	0.990	Ribosome biogenesis protein BOP1
9	9606.ENSP00000354040	0.988	Nucleolar GTP-binding protein 1
10	9606.ENSP00000359688	0.988	Ribosome production factor 1
11	9606.ENSP00000364320	0.988	mRNA turnover protein 4 homolog
12	9606.ENSP00000263239	0.987	ATP-dependent RNA helicase DDX18
13	9606.ENSP00000483484	0.987	Ribosome biogenesis protein NSA2 homolog
14	9606.ENSP00000371858	0.985	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
15	9606.ENSP00000481495	0.982	ATP-dependent RNA helicase DDX24
16	9606.ENSP00000386226	0.981	RNA-binding protein 34
17	9606.ENSP00000402338	0.981	Ribosome production factor 2 homolog
18	9606.ENSP00000432119	0.980	WD repeat-containing protein 74
19	9606.ENSP00000258772	0.978	Probable ATP-dependent RNA helicase DDX56
20	9606.ENSP00000264279	0.975	Nucleolar protein 58

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0019843	0.491	rRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0044238	0.974	primary metabolic process
GO:0034641	0.972	cellular nitrogen compound metabolic process
GO:0043170	0.948	macromolecule metabolic process
GO:0006139	0.937	nucleobase-containing compound metabolic process
GO:0010467	0.923	gene expression
GO:0016070	0.915	RNA metabolic process
GO:0071840	0.855	cellular component organization or biogenesis
GO:0006396	0.814	RNA processing
GO:0022613	0.798	ribonucleoprotein complex biogenesis
GO:0034660	0.765	ncRNA metabolic process
GO:0065007	0.604	biological regulation
GO:0042254	0.593	ribosome biogenesis
GO:0050794	0.586	regulation of cellular process
GO:0034470	0.577	ncRNA processing
GO:0016072	0.441	rRNA metabolic process
GO:0006364	0.405	rRNA processing
GO:0016043	0.363	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005654	0.979	nucleoplasm
GO:0005694	0.906	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]