StarFunc result for job id Q8TDQ0

User Input

>input (301 residues)
MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPV
FECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMND
EKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLA
NELRDSRLANDLRDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLI
SLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSRQQPSQPLGCRFAM
P

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDQ0	1.000	1.000	7.640E-50	301	1.000	1.000	Q8TDQ0.pdb.gz	HAVR2_HUMAN Hepatitis A virus cellular receptor 2 OS=Homo sapiens OX=9606 GN=HAVCR2 PE=1 SV=3
2	AFDB:Q8VIM0	0.544	0.578	2.501E-32	281	0.621	0.665	Q8VIM0.pdb.gz	HAVR2_MOUSE Hepatitis A virus cellular receptor 2 homolog OS=Mus musculus OX=10090 GN=Havcr2 PE=1 SV=1
3	AFDB:P0C0K5	0.669	0.708	2.223E-31	282	0.625	0.667	P0C0K5.pdb.gz	HAVR2_RAT Hepatitis A virus cellular receptor 2 homolog OS=Rattus norvegicus OX=10116 GN=Havcr2 PE=2 SV=2
4	AFDB:O54947	0.428	0.420	1.477E-16	307	0.296	0.290	O54947.pdb.gz	HAVR1_RAT Hepatitis A virus cellular receptor 1 homolog OS=Rattus norvegicus OX=10116 GN=Havcr1 PE=2 SV=1
5	AFDB:Q6DH50	0.393	0.446	3.801E-15	264	0.236	0.269	Q6DH50.pdb.gz	Q6DH50_DANRE Hepatitis A virus cellular receptor 1 OS=Danio rerio OX=7955 GN=DrTIM-4 PE=2 SV=1
6	AFDB:Q5QNS5	0.386	0.381	6.096E-15	305	0.256	0.252	Q5QNS5.pdb.gz	HAVR1_MOUSE Hepatitis A virus cellular receptor 1 homolog OS=Mus musculus OX=10090 GN=Havcr1 PE=1 SV=2
7	AFDB:A0A1C6ZYS3	0.400	0.407	4.279E-14	295	0.252	0.258	A0A1C6ZYS3.pdb.gz	A0A1C6ZYS3_DANRE Hepatitis A virus cellular receptor 1 homolog isoform X4 OS=Danio rerio OX=7955 GN=zgc:92647 PE=2 SV=1
8	AFDB:A0A2R8QGQ2	0.429	0.401	4.279E-14	324	0.249	0.231	A0A2R8QGQ2.pdb.gz	A0A2R8QGQ2_DANRE Hepatitis A virus cellular receptor 1 OS=Danio rerio OX=7955 GN=DrTIM-4 PE=4 SV=1
9	AFDB:Q8R183	0.395	0.390	8.691E-14	305	0.279	0.275	Q8R183.pdb.gz	TIMD2_MOUSE T-cell immunoglobulin and mucin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Timd2 PE=1 SV=1
10	AFDB:Q6U7R4	0.438	0.389	1.168E-13	343	0.243	0.213	Q6U7R4.pdb.gz	TIMD4_MOUSE T-cell immunoglobulin and mucin domain-containing protein 4 OS=Mus musculus OX=10090 GN=Timd4 PE=1 SV=2
11	PDB:3oaiA	0.308	0.194	3.756E-7	488	0.066	0.041	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
12	PDB:6dldD	0.274	0.303	6.024E-7	269	0.063	0.071	6dldD.pdb.gz
13	PDB:6jxrm	0.272	0.326	5.680E-6	248	0.070	0.085	6jxrm.pdb.gz
14	PDB:6dlfA	0.278	0.349	7.631E-6	236	0.063	0.081	6dlfA.pdb.gz
15	PDB:4adfM	0.291	0.448	8.095E-6	191	0.050	0.079	4adfM.pdb.gz
16	PDB:6hd8A	0.267	0.182	1.154E-5	461	0.063	0.041	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
17	PDB:5hhmI	0.268	0.396	1.377E-5	196	0.086	0.133	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
18	PDB:1ezvX	0.279	0.605	1.461E-5	127	0.063	0.150	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
19	PDB:1bd2D	0.295	0.448	1.550E-5	190	0.076	0.121	1bd2D.pdb.gz	Two human T cell receptors bind in a similar diagonal mode to the HLA-A2/Tax peptide complex using different TCR amino acids.
20	PDB:6xdsA	0.237	0.154	1.850E-5	485	0.060	0.037	6xdsA.pdb.gz	Development of a robust crystallization platform for immune receptor TREM2 using a crystallization chaperone strategy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TDQ0	0.0	622	301	1.000	1.000	HAVR2_HUMAN Hepatitis A virus cellular receptor 2 OS=Homo sapiens OX=9606 GN=HAVCR2 PE=1 SV=3
2	P0C0K5	5.77e-121	350	282	0.631	0.674	HAVR2_RAT Hepatitis A virus cellular receptor 2 homolog OS=Rattus norvegicus OX=10116 GN=Havcr2 PE=2 SV=2
3	Q8VIM0	3.90e-105	310	281	0.571	0.612	HAVR2_MOUSE Hepatitis A virus cellular receptor 2 homolog OS=Mus musculus OX=10090 GN=Havcr2 PE=1 SV=1
4	Q5QNS5	4.93e-26	106	305	0.309	0.305	HAVR1_MOUSE Hepatitis A virus cellular receptor 1 homolog OS=Mus musculus OX=10090 GN=Havcr1 PE=1 SV=2
5	O54947	5.38e-26	106	307	0.272	0.267	HAVR1_RAT Hepatitis A virus cellular receptor 1 homolog OS=Rattus norvegicus OX=10116 GN=Havcr1 PE=2 SV=1
6	Q96D42	7.02e-22	96.3	364	0.173	0.143	HAVR1_HUMAN Hepatitis A virus cellular receptor 1 OS=Homo sapiens OX=9606 GN=HAVCR1 PE=1 SV=3
7	Q6U7R4	3.67e-20	91.3	343	0.150	0.131	TIMD4_MOUSE T-cell immunoglobulin and mucin domain-containing protein 4 OS=Mus musculus OX=10090 GN=Timd4 PE=1 SV=2
8	O46598	8.85e-20	91.3	478	0.166	0.105	HAVR1_CHLAE Hepatitis A virus cellular receptor 1 OS=Chlorocebus aethiops OX=9534 GN=HAVCR1 PE=1 SV=2
9	Q8R183	1.43e-18	86.3	305	0.272	0.269	TIMD2_MOUSE T-cell immunoglobulin and mucin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Timd2 PE=1 SV=1
10	A0A1C6ZYS3	2.76e-18	85.1	295	0.159	0.163	A0A1C6ZYS3_DANRE Hepatitis A virus cellular receptor 1 homolog isoform X4 OS=Danio rerio OX=7955 GN=zgc:92647 PE=2 SV=1
11	A0A2R8QGQ2	4.46e-18	85.1	324	0.159	0.148	A0A2R8QGQ2_DANRE Hepatitis A virus cellular receptor 1 OS=Danio rerio OX=7955 GN=DrTIM-4 PE=4 SV=1
12	Q6DH50	4.63e-18	84.0	264	0.186	0.212	Q6DH50_DANRE Hepatitis A virus cellular receptor 1 OS=Danio rerio OX=7955 GN=DrTIM-4 PE=2 SV=1
13	Q6ZMC9	7.44e-06	49.3	328	0.213	0.195	SIG15_HUMAN Sialic acid-binding Ig-like lectin 15 OS=Homo sapiens OX=9606 GN=SIGLEC15 PE=1 SV=1
14	A7E1W8	3.24e-05	47.4	342	0.120	0.105	A7E1W8_MOUSE SIGLEC-I OS=Mus musculus OX=10090 GN=Siglec15 PE=2 SV=1
15	A4QPC6	8.38e-05	46.2	514	0.103	0.060	BT2A2_MOUSE Butyrophilin subfamily 2 member A2 OS=Mus musculus OX=10090 GN=Btn2a2 PE=1 SV=1
16	Q9R066	1.11e-04	45.4	365	0.110	0.090	CXAR_RAT Coxsackievirus and adenovirus receptor homolog OS=Rattus norvegicus OX=10116 GN=Cxadr PE=1 SV=2
17	P97792	1.64e-04	45.1	365	0.106	0.088	CXAR_MOUSE Coxsackievirus and adenovirus receptor homolog OS=Mus musculus OX=10090 GN=Cxadr PE=1 SV=1
18	Q9UIR0	1.70e-04	45.1	455	0.113	0.075	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1
19	P78310	2.76e-04	44.3	365	0.116	0.096	CXAR_HUMAN Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1
20	Q8WVV5	3.90e-04	44.3	523	0.116	0.067	BT2A2_HUMAN Butyrophilin subfamily 2 member A2 OS=Homo sapiens OX=9606 GN=BTN2A2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	4	18.9	Immunoglobulin I-set domain
2	PF00047 ig	1.7	20.2	Immunoglobulin domain
3	PF13895 Ig_2	1.1	20.9	Immunoglobulin domain
4	PF13927 Ig_3	14	17.6	Immunoglobulin domain
5	PF11465 Receptor_2B4	4.1e+02	12.6	Natural killer cell receptor 2B4
6	PF07686 V-set	2.9e-10	51.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312002

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378856	0.999	Galectin-9
2	9606.ENSP00000161559	0.992	Carcinoembryonic antigen-related cell adhesion molecule 1
3	9606.ENSP00000345347	0.990	High mobility group protein B1
4	9606.ENSP00000346671	0.980	Tyrosine-protein kinase Fyn
5	9606.ENSP00000365131	0.970	Large proline-rich protein BAG6
6	9606.ENSP00000221992	0.939	Carcinoembryonic antigen-related cell adhesion molecule 5
7	9606.ENSP00000203629	0.913	Lymphocyte activation gene 3 protein
8	9606.ENSP00000370989	0.885	Programmed cell death 1 ligand 1
9	9606.ENSP00000303939	0.867	Cytotoxic T-lymphocyte protein 4
10	9606.ENSP00000419085	0.861	T-cell immunoreceptor with Ig and ITIM domains
11	9606.ENSP00000329797	0.842	Cell adhesion molecule 1
12	9606.ENSP00000386559	0.833	T-cell surface glycoprotein CD8 alpha chain
13	9606.ENSP00000335062	0.830	Programmed cell death protein 1
14	9606.ENSP00000286317	0.820	Mediator of RNA polymerase II transcription subunit 7
15	9606.ENSP00000011653	0.817	T-cell surface glycoprotein CD4
16	9606.ENSP00000333919	0.809	B- and T-lymphocyte attenuator
17	9606.ENSP00000478699	0.794	Tumor necrosis factor receptor superfamily member 9
18	9606.ENSP00000337825	0.784	Tyrosine-protein kinase Lck
19	9606.ENSP00000264972	0.781	Tyrosine-protein kinase ZAP-70
20	9606.ENSP00000235933	0.775	CD160 antigen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.994	positive regulation of biological process
GO:0030155	0.989	regulation of cell adhesion
GO:0001817	0.987	regulation of cytokine production
GO:0051249	0.984	regulation of lymphocyte activation
GO:0009893	0.975	positive regulation of metabolic process
GO:0051240	0.974	positive regulation of multicellular organismal process
GO:0032501	0.973	multicellular organismal process
GO:0048523	0.970	negative regulation of cellular process
GO:0002376	0.969	immune system process
GO:0010604	0.967	positive regulation of macromolecule metabolic process
GO:0051241	0.961	negative regulation of multicellular organismal process
GO:0048583	0.951	regulation of response to stimulus
GO:0010628	0.951	positive regulation of gene expression
GO:0022407	0.948	regulation of cell-cell adhesion
GO:0009892	0.941	negative regulation of metabolic process
GO:1903037	0.938	regulation of leukocyte cell-cell adhesion
GO:0002683	0.927	negative regulation of immune system process
GO:0010605	0.926	negative regulation of macromolecule metabolic process
GO:0009987	0.922	cellular process
GO:0050776	0.922	regulation of immune response
GO:0080090	0.920	regulation of primary metabolic process
GO:0051171	0.918	regulation of nitrogen compound metabolic process
GO:0031323	0.916	regulation of cellular metabolic process
GO:0050896	0.900	response to stimulus
GO:0019219	0.878	regulation of nucleobase-containing compound metabolic process
GO:0002695	0.877	negative regulation of leukocyte activation
GO:0051252	0.873	regulation of RNA metabolic process
GO:0044706	0.861	multi-multicellular organism process
GO:0065009	0.858	regulation of molecular function
GO:0001818	0.847	negative regulation of cytokine production
GO:0032649	0.846	regulation of type II interferon production
GO:0007162	0.817	negative regulation of cell adhesion
GO:0031326	0.816	regulation of cellular biosynthetic process
GO:0051250	0.813	negative regulation of lymphocyte activation
GO:0032689	0.806	negative regulation of type II interferon production
GO:0022408	0.805	negative regulation of cell-cell adhesion
GO:2001141	0.805	regulation of RNA biosynthetic process
GO:1903038	0.803	negative regulation of leukocyte cell-cell adhesion
GO:1903555	0.797	regulation of tumor necrosis factor superfamily cytokine production
GO:0006355	0.797	regulation of DNA-templated transcription
GO:0022414	0.781	reproductive process
GO:0048522	0.764	positive regulation of cellular process
GO:0050863	0.753	regulation of T cell activation
GO:0044703	0.699	multi-organism reproductive process
GO:0001819	0.692	positive regulation of cytokine production
GO:0002697	0.681	regulation of immune effector process
GO:0032479	0.655	regulation of type I interferon production
GO:0007565	0.637	female pregnancy
GO:0032663	0.613	regulation of interleukin-2 production
GO:0048856	0.588	anatomical structure development
GO:0002698	0.504	negative regulation of immune effector process
GO:0051090	0.466	regulation of DNA-binding transcription factor activity
GO:0051716	0.465	cellular response to stimulus
GO:0032480	0.422	negative regulation of type I interferon production
GO:0007154	0.416	cell communication
GO:0002684	0.413	positive regulation of immune system process
GO:0032680	0.407	regulation of tumor necrosis factor production
GO:0023052	0.395	signaling
GO:0006955	0.394	immune response
GO:0050868	0.387	negative regulation of T cell activation
GO:0007165	0.386	signal transduction
GO:0048585	0.380	negative regulation of response to stimulus
GO:0044092	0.362	negative regulation of molecular function
GO:0007275	0.336	multicellular organism development
GO:0048584	0.329	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	1.000	cell surface
GO:0005622	0.822	intracellular anatomical structure
GO:0043226	0.781	organelle
GO:0005737	0.736	cytoplasm
GO:0016020	0.678	membrane
GO:0043229	0.678	intracellular organelle
GO:0043227	0.461	membrane-bounded organelle
GO:0005886	0.417	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]