StarFunc result for job id Q8TDQ1

User Input

>input (290 residues)
MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWR
DCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVT
VQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRM
MKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMA
SLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEEPTEYSTISRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDQ1	1.000	1.000	2.038E-48	290	1.000	1.000	Q8TDQ1.pdb.gz	CLM1_HUMAN CMRF35-like molecule 1 OS=Homo sapiens OX=9606 GN=CD300LF PE=1 SV=3
2	AFDB:Q6SJQ7	0.407	0.352	1.142E-27	337	0.562	0.484	Q6SJQ7.pdb.gz	CLM1_MOUSE CMRF35-like molecule 1 OS=Mus musculus OX=10090 GN=Cd300lf PE=1 SV=1
3	AFDB:Q6UXZ3	0.390	0.578	4.203E-22	194	0.338	0.505	Q6UXZ3.pdb.gz	CLM5_HUMAN CMRF35-like molecule 5 OS=Homo sapiens OX=9606 GN=CD300LD PE=1 SV=1
4	AFDB:A8K4G0	0.456	0.633	4.712E-22	201	0.328	0.473	A8K4G0.pdb.gz	CLM7_HUMAN CMRF35-like molecule 7 OS=Homo sapiens OX=9606 GN=CD300LB PE=1 SV=2
5	AFDB:Q3U497	0.453	0.608	2.057E-20	209	0.248	0.344	Q3U497.pdb.gz	CLM7_MOUSE CMRF35-like molecule 7 OS=Mus musculus OX=10090 GN=Cd300lb PE=1 SV=2
6	AFDB:Q6SJQ5	0.492	0.575	2.274E-19	245	0.286	0.339	Q6SJQ5.pdb.gz	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1
7	AFDB:Q8VCH2	0.411	0.536	4.519E-19	221	0.300	0.394	Q8VCH2.pdb.gz	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
8	AFDB:Q496F6	0.400	0.553	2.742E-16	205	0.217	0.307	Q496F6.pdb.gz	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
9	AFDB:A0A0K2S4Q6	0.371	0.522	1.130E-14	201	0.197	0.284	A0A0K2S4Q6.pdb.gz	CD3CH_HUMAN Protein CD300H OS=Homo sapiens OX=9606 GN=CD300H PE=1 SV=1
10	AFDB:Q1ERP8	0.362	0.321	1.114E-13	331	0.245	0.215	Q1ERP8.pdb.gz	CLM9_MOUSE CMRF35-like molecule 9 OS=Mus musculus OX=10090 GN=Cd300lg PE=1 SV=1
11	PDB:1cd0A	0.318	0.765	2.503E-8	111	0.059	0.153	1cd0A.pdb.gz
12	PDB:6xdsA	0.324	0.199	8.324E-8	485	0.110	0.066	6xdsA.pdb.gz	Development of a robust crystallization platform for immune receptor TREM2 using a crystallization chaperone strategy.
13	PDB:2cd0A	0.310	0.745	1.108E-7	111	0.072	0.189	2cd0A.pdb.gz
14	PDB:5ir3A	0.316	0.766	1.108E-7	111	0.062	0.162	5ir3A.pdb.gz
15	PDB:3zhlA	0.295	0.646	1.173E-7	121	0.086	0.207	3zhlA.pdb.gz
16	PDB:5hhmI	0.335	0.484	1.173E-7	196	0.066	0.097	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
17	PDB:3oaiA	0.315	0.193	1.475E-7	488	0.052	0.031	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
18	PDB:6sm1A	0.302	0.716	1.751E-7	111	0.076	0.198	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
19	PDB:1a8jL	0.309	0.405	2.468E-7	216	0.097	0.130	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
20	PDB:2jb5L	0.305	0.409	3.103E-7	211	0.083	0.114	2jb5L.pdb.gz	Fab Mor03268 Triggers Absorption Shift of a Diagnostic Dye Via Packaging in a Solvent-Shielded Fab Dimer Interface

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TDQ1	0.0	596	290	1.000	1.000	CLM1_HUMAN CMRF35-like molecule 1 OS=Homo sapiens OX=9606 GN=CD300LF PE=1 SV=3
2	Q6SJQ7	5.01e-78	242	337	0.552	0.475	CLM1_MOUSE CMRF35-like molecule 1 OS=Mus musculus OX=10090 GN=Cd300lf PE=1 SV=1
3	Q6UXZ3	1.26e-55	180	194	0.290	0.433	CLM5_HUMAN CMRF35-like molecule 5 OS=Homo sapiens OX=9606 GN=CD300LD PE=1 SV=1
4	A8K4G0	1.00e-51	170	201	0.303	0.438	CLM7_HUMAN CMRF35-like molecule 7 OS=Homo sapiens OX=9606 GN=CD300LB PE=1 SV=2
5	Q3U497	1.54e-40	142	209	0.262	0.364	CLM7_MOUSE CMRF35-like molecule 7 OS=Mus musculus OX=10090 GN=Cd300lb PE=1 SV=2
6	Q6SJQ5	3.79e-40	142	245	0.238	0.282	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1
7	Q8VCH2	9.42e-40	140	221	0.290	0.380	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
8	Q6SJQ0	2.99e-24	101	318	0.348	0.318	CLM8_MOUSE CMRF35-like molecule 8 OS=Mus musculus OX=10090 GN=Cd300a PE=1 SV=2
9	Q9UGN4	9.12e-20	89.4	299	0.314	0.304	CLM8_HUMAN CMRF35-like molecule 8 OS=Homo sapiens OX=9606 GN=CD300A PE=1 SV=2
10	Q7TSN2	1.34e-19	87.4	228	0.193	0.246	CLM4_MOUSE CMRF-35-like molecule 4 OS=Mus musculus OX=10090 GN=Cd300c2 PE=1 SV=2
11	Q08708	2.92e-19	86.3	224	0.193	0.250	CLM6_HUMAN CMRF35-like molecule 6 OS=Homo sapiens OX=9606 GN=CD300C PE=1 SV=1
12	Q496F6	8.72e-18	81.6	205	0.162	0.229	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
13	A0A0K2S4Q6	6.74e-17	79.3	201	0.193	0.279	CD3CH_HUMAN Protein CD300H OS=Homo sapiens OX=9606 GN=CD300H PE=1 SV=1
14	Q1ERP8	1.57e-15	77.8	331	0.145	0.127	CLM9_MOUSE CMRF35-like molecule 9 OS=Mus musculus OX=10090 GN=Cd300lg PE=1 SV=1
15	Q6UXG3	2.00e-15	77.4	332	0.117	0.102	CLM9_HUMAN CMRF35-like molecule 9 OS=Homo sapiens OX=9606 GN=CD300LG PE=1 SV=2
16	P15083	1.61e-08	57.8	769	0.128	0.048	PIGR_RAT Polymeric immunoglobulin receptor OS=Rattus norvegicus OX=10116 GN=Pigr PE=1 SV=1
17	P01832	1.78e-08	57.8	773	0.152	0.057	PIGR_RABIT Polymeric immunoglobulin receptor OS=Oryctolagus cuniculus OX=9986 GN=PIGR PE=1 SV=1
18	P01833	9.37e-08	55.5	764	0.107	0.041	PIGR_HUMAN Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4
19	Q8WWV6	9.41e-08	55.1	532	0.124	0.068	FCAMR_HUMAN High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor OS=Homo sapiens OX=9606 GN=FCAMR PE=1 SV=1
20	Q3LRV9	2.40e-07	53.1	263	0.117	0.129	TRML4_MOUSE Trem-like transcript 4 protein OS=Mus musculus OX=10090 GN=Treml4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	1.3e+02	14.1	Immunoglobulin domain
2	PF14610 Psg1	2.5e+02	12.9	Ykl077w/Psg1 (Pma1 Stabilization in Golgi)
3	PF15330 SIT	1.3e-32	124.0	SHP2-interacting transmembrane adaptor protein, SIT
4	PF15102 TMEM154	1.5e+02	13.6	TMEM154 protein family
5	PF07686 V-set	3.8e-09	48.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000462309

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262629	0.898	TYRO protein tyrosine kinase-binding protein
2	9606.ENSP00000289902	0.869	High affinity immunoglobulin epsilon receptor subunit gamma
3	9606.ENSP00000428056	0.819	Phosphatidylinositol 3-kinase regulatory subunit alpha
4	9606.ENSP00000402855	0.775	Trem-like transcript 1 protein
5	9606.ENSP00000244709	0.767	Triggering receptor expressed on myeloid cells 1
6	9606.ENSP00000391592	0.724	Tyrosine-protein phosphatase non-receptor type 6
7	9606.ENSP00000329507	0.718	CMRF35-like molecule 6
8	9606.ENSP00000480132	0.714	Neural cell adhesion molecule 1
9	9606.ENSP00000405338	0.702	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
10	9606.ENSP00000376397	0.676	CMRF35-like molecule 7
11	9606.ENSP00000264025	0.672	Nectin-1
12	9606.ENSP00000227163	0.665	Transcription factor PU.1
13	9606.ENSP00000362205	0.650	Triggering receptor expressed on myeloid cells 2
14	9606.ENSP00000284878	0.632	Coxsackievirus and adenovirus receptor
15	9606.ENSP00000342570	0.627	Trem-like transcript 4 protein
16	9606.ENSP00000353259	0.622	CMRF35-like molecule 8
17	9606.ENSP00000482263	0.619	annotation not available
18	9606.ENSP00000363089	0.606	Toll-like receptor 4
19	9606.ENSP00000413861	0.600	Sialic acid-binding Ig-like lectin 9
20	9606.ENSP00000323328	0.598	Sialic acid-binding Ig-like lectin 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0033218	0.996	amide binding
GO:0008289	0.996	lipid binding
GO:0046625	0.991	sphingolipid binding
GO:0097001	0.937	ceramide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0048583	0.993	regulation of response to stimulus
GO:0002376	0.991	immune system process
GO:0002694	0.990	regulation of leukocyte activation
GO:0002684	0.989	positive regulation of immune system process
GO:0032101	0.984	regulation of response to external stimulus
GO:0031347	0.982	regulation of defense response
GO:0007165	0.975	signal transduction
GO:0050778	0.971	positive regulation of immune response
GO:0002764	0.969	immune response-regulating signaling pathway
GO:0045088	0.966	regulation of innate immune response
GO:0002683	0.936	negative regulation of immune system process
GO:0050866	0.936	negative regulation of cell activation
GO:0032103	0.924	positive regulation of response to external stimulus
GO:0023051	0.921	regulation of signaling
GO:0010646	0.918	regulation of cell communication
GO:0031349	0.908	positive regulation of defense response
GO:0002757	0.906	immune response-activating signaling pathway
GO:0009966	0.902	regulation of signal transduction
GO:0045089	0.889	positive regulation of innate immune response
GO:0002695	0.872	negative regulation of leukocyte activation
GO:0002758	0.847	innate immune response-activating signaling pathway
GO:0002221	0.805	pattern recognition receptor signaling pathway
GO:0062207	0.714	regulation of pattern recognition receptor signaling pathway
GO:0033003	0.651	regulation of mast cell activation
GO:0002224	0.580	toll-like receptor signaling pathway
GO:0048522	0.411	positive regulation of cellular process
GO:0019222	0.359	regulation of metabolic process
GO:0048585	0.332	negative regulation of response to stimulus
GO:0007166	0.316	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.905	organelle
GO:0043227	0.894	membrane-bounded organelle
GO:0031982	0.785	vesicle
GO:0005622	0.735	intracellular anatomical structure
GO:0005737	0.708	cytoplasm
GO:0043229	0.692	intracellular organelle
GO:0043231	0.670	intracellular membrane-bounded organelle
GO:0012505	0.444	endomembrane system
GO:0097708	0.315	intracellular vesicle
GO:0031410	0.310	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]