StarFunc result for job id Q8TDQ7

User Input

>input (276 residues)
MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGH
LSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDA
FENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSK
VPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCD
EDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDQ7	1.000	1.000	8.258E-63	276	1.000	1.000	Q8TDQ7.pdb.gz	GNPI2_HUMAN Glucosamine-6-phosphate isomerase 2 OS=Homo sapiens OX=9606 GN=GNPDA2 PE=1 SV=1
2	AFDB:A4FV08	0.996	0.951	1.345E-58	289	0.888	0.848	A4FV08.pdb.gz	GNPI1_BOVIN Glucosamine-6-phosphate isomerase 1 OS=Bos taurus OX=9913 GN=GNPDA1 PE=1 SV=1
3	PDB:1ne7A	0.984	0.967	1.586E-55	281	0.870	0.854	1ne7A.pdb.gz	Two mammalian glucosamine-6-phosphate deaminases: a structural and genetic study.
4	AFDB:O30564	0.942	0.970	1.981E-43	268	0.569	0.586	O30564.pdb.gz	NAGB_BORBU Glucosamine-6-phosphate deaminase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=nagB PE=1 SV=1
5	PDB:3hn6A	0.936	0.953	3.489E-43	271	0.565	0.576	3hn6A.pdb.gz	Crystal Structure of Glucosamine-6-phosphate deaminase from Borrelia burgdorferi
6	AFDB:P0A759	0.946	0.981	2.609E-42	266	0.558	0.579	P0A759.pdb.gz	NAGB_ECOLI Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain K12) OX=83333 GN=nagB PE=1 SV=1
7	PDB:1deaA	0.945	0.980	6.246E-42	266	0.558	0.579	1deaA.pdb.gz	Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from Escherichia coli at 2.1 A resolution.
8	AFDB:Q381A9	0.939	0.926	5.440E-40	280	0.496	0.489	Q381A9.pdb.gz	Q381A9_TRYB2 Glucosamine-6-phosphate isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8520 PE=3 SV=1
9	AFDB:Q54M58	0.847	0.328	8.024E-27	724	0.286	0.109	Q54M58.pdb.gz	Q54M58_DICDI Glucosamine-6-phosphate isomerase OS=Dictyostelium discoideum OX=44689 GN=nagB1 PE=3 SV=1
10	AFDB:Q8DV70	0.805	0.950	9.072E-27	233	0.293	0.348	Q8DV70.pdb.gz	NAGB_STRMU Glucosamine-6-phosphate deaminase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=nagB PE=1 SV=1
11	PDB:2ri1A	0.772	0.900	1.411E-24	235	0.293	0.345	2ri1A.pdb.gz	Ring-opening mechanism revealed by crystal structures of NagB and its ES intermediate complex
12	AFDB:D4A7D7	0.703	0.257	3.365E-15	797	0.170	0.059	D4A7D7.pdb.gz	D4A7D7_RAT Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) OS=Rattus norvegicus OX=10116 GN=H6pd PE=4 SV=1
13	PDB:3icoC	0.705	0.781	3.412E-15	247	0.225	0.251	3icoC.pdb.gz
14	AFDB:P9WQP5	0.716	0.793	5.499E-15	247	0.217	0.243	P9WQP5.pdb.gz	6PGL_MYCTU 6-phosphogluconolactonase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pgl PE=1 SV=1
15	PDB:3e7fB	0.711	0.743	1.030E-14	263	0.188	0.198	3e7fB.pdb.gz	Insights into the enzymatic mechanism of 6-phosphogluconolactonase from Trypanosoma brucei using structural data and molecular dynamics simulation.
16	AFDB:O95336	0.720	0.767	2.399E-14	258	0.185	0.198	O95336.pdb.gz	6PGL_HUMAN 6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2
17	PDB:4l5jA	0.440	0.401	1.391E-6	308	0.105	0.094	4l5jA.pdb.gz	Crystal Structures of the LsrR Proteins Complexed with Phospho-AI-2 and Two Signal-Interrupting Analogues Reveal Distinct Mechanisms for Ligand Recognition.
18	PDB:1lk7A	0.236	0.275	4.062E-3	229	0.116	0.140	1lk7A.pdb.gz	A Hyperthermostable D-Ribose-5-Phosphate Isomerase from Pyrococcus horikoshii Characterization and Three-Dimensional Structure
19	PDB:3ixqA	0.246	0.290	5.193E-3	225	0.080	0.098	3ixqA.pdb.gz
20	PDB:3s8mA	0.242	0.190	7.058E-3	390	0.120	0.085	3s8mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4FV08	0.0	521	289	0.888	0.848	GNPI1_BOVIN Glucosamine-6-phosphate isomerase 1 OS=Bos taurus OX=9913 GN=GNPDA1 PE=1 SV=1
2	O88958	0.0	515	289	0.870	0.830	GNPI1_MOUSE Glucosamine-6-phosphate isomerase 1 OS=Mus musculus OX=10090 GN=Gnpda1 PE=1 SV=3
3	P46926	0.0	516	289	0.873	0.834	GNPI1_HUMAN Glucosamine-6-phosphate isomerase 1 OS=Homo sapiens OX=9606 GN=GNPDA1 PE=1 SV=1
4	Q8TDQ7	0.0	578	276	1.000	1.000	GNPI2_HUMAN Glucosamine-6-phosphate isomerase 2 OS=Homo sapiens OX=9606 GN=GNPDA2 PE=1 SV=1
5	P0A759	5.99e-115	333	266	0.554	0.575	NAGB_ECOLI Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain K12) OX=83333 GN=nagB PE=1 SV=1
6	O30564	7.83e-112	325	268	0.565	0.582	NAGB_BORBU Glucosamine-6-phosphate deaminase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=nagB PE=1 SV=1
7	Q381A9	8.69e-103	302	280	0.493	0.486	Q381A9_TRYB2 Glucosamine-6-phosphate isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8520 PE=3 SV=1
8	Q8DV70	1.11e-36	132	233	0.272	0.322	NAGB_STRMU Glucosamine-6-phosphate deaminase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=nagB PE=1 SV=1
9	Q54M58	4.57e-34	132	724	0.283	0.108	Q54M58_DICDI Glucosamine-6-phosphate isomerase OS=Dictyostelium discoideum OX=44689 GN=nagB1 PE=3 SV=1
10	Q84WW2	1.10e-08	57.4	325	0.163	0.138	6PGL3_ARATH 6-phosphogluconolactonase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGL3 PE=1 SV=1
11	P9WQP5	7.00e-06	48.5	247	0.188	0.211	6PGL_MYCTU 6-phosphogluconolactonase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pgl PE=1 SV=1
12	Q385D6	3.71e-05	46.6	266	0.192	0.199	Q385D6_TRYB2 6-phosphogluconolactonase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4200 PE=3 SV=1
13	P85971	7.03e-05	45.4	257	0.221	0.237	6PGL_RAT 6-phosphogluconolactonase OS=Rattus norvegicus OX=10116 GN=Pgls PE=1 SV=1
14	Q9GRG6	7.19e-05	45.4	266	0.192	0.199	Q9GRG6_9TRYP 6-phosphogluconolactonase OS=Trypanosoma brucei OX=5691 GN=6pgl PE=1 SV=1
15	O95336	0.002	41.2	258	0.199	0.213	6PGL_HUMAN 6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2
16	O74455	0.028	37.7	257	0.199	0.214	6PGL_SCHPO Probable 6-phosphogluconolactonase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC16C4.10 PE=3 SV=1
17	A0A8I6ANS1	0.033	38.1	796	0.156	0.054	A0A8I6ANS1_RAT Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) OS=Rattus norvegicus OX=10116 GN=H6pd PE=1 SV=1
18	D4A7D7	0.034	38.1	797	0.156	0.054	D4A7D7_RAT Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) OS=Rattus norvegicus OX=10116 GN=H6pd PE=4 SV=1
19	Q8CFX1	0.034	38.1	789	0.120	0.042	G6PE_MOUSE GDH/6PGL endoplasmic bifunctional protein OS=Mus musculus OX=10090 GN=H6pd PE=1 SV=2
20	A0A8I5ZNT3	0.035	38.1	796	0.156	0.054	A0A8I5ZNT3_RAT Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) OS=Rattus norvegicus OX=10116 GN=H6pd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01182 Glucosamine_iso	7.1e-17	73.6	Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295448

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000391596	0.997	N-acetylglucosamine-6-phosphate deacetylase
2	9606.ENSP00000455561	0.958	Uncharacterized protein
3	9606.ENSP00000216410	0.939	Glucosamine-phosphate N-acetyltransferase 1
4	9606.ENSP00000318318	0.931	Mannose-6-phosphate isomerase
5	9606.ENSP00000405573	0.931	Glucose-6-phosphate isomerase
6	9606.ENSP00000423674	0.927	Glucosamine-6-phosphate isomerase 1
7	9606.ENSP00000290573	0.923	Hexokinase-2
8	9606.ENSP00000292432	0.923	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
9	9606.ENSP00000346643	0.923	Putative hexokinase HKDC1
10	9606.ENSP00000402103	0.923	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
11	9606.ENSP00000253778	0.918	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
12	9606.ENSP00000349860	0.911	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
13	9606.ENSP00000281017	0.870	Transmembrane protein 18
14	9606.ENSP00000394390	0.870	BTB/POZ domain-containing protein KCTD15
15	9606.ENSP00000303222	0.859	Mitochondrial carrier homolog 2
16	9606.ENSP00000308339	0.858	Protein transport protein Sec16B
17	9606.ENSP00000321221	0.856	SH2B adapter protein 1
18	9606.ENSP00000350364	0.856	Neuronal growth regulator 1
19	9606.ENSP00000418823	0.805	Alpha-ketoglutarate-dependent dioxygenase FTO
20	9606.ENSP00000299766	0.804	Melanocortin receptor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004342	1.000	glucosamine-6-phosphate deaminase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.992	cellular metabolic process
GO:0044238	0.989	primary metabolic process
GO:0071704	0.988	organic substance metabolic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0006793	0.943	phosphorus metabolic process
GO:0044281	0.911	small molecule metabolic process
GO:1901135	0.894	carbohydrate derivative metabolic process
GO:1901360	0.876	organic cyclic compound metabolic process
GO:0034641	0.876	cellular nitrogen compound metabolic process
GO:0055086	0.874	nucleobase-containing small molecule metabolic process
GO:1901137	0.857	carbohydrate derivative biosynthetic process
GO:0009225	0.801	nucleotide-sugar metabolic process
GO:0006040	0.796	amino sugar metabolic process
GO:0044249	0.795	cellular biosynthetic process
GO:0009226	0.787	nucleotide-sugar biosynthetic process
GO:0046349	0.727	amino sugar biosynthetic process
GO:1901564	0.322	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0005634	0.963	nucleus
GO:0070013	0.417	intracellular organelle lumen
GO:0031981	0.376	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12172	1.000	alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6-phosphate + NH4(+)
EC:3.5.99.6	1.000	glucosamine-6-phosphate deaminase.

[back to server]